(data stored in ACNUC7421 zone)

EMBL: CP000489.PE497

CP000489.PE497       Location/Qualifiers
FT   CDS_pept        complement(474003..474617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0502"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="KEGG: rsp:RSP_0986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68614"
FT                   /db_xref="GOA:A1AZC0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC0"
FT                   /protein_id="ABL68614.1"
FT                   /translation="MEEILDRIAGLGPGRRVLAVLGAPGSGKSTLAAQLAAGLDDAVLV
FT                   PMDGFHLDNRLLEADGRRGCKGAPETFDAAGFVALVQRLKAGGEVIHPIFDRALDLAIA
FT                   GAGRVEAETRLVVVEGNYLLLDRDPWRELAGLWDLSVMLDVPMEELRRRLTARWQGLGR
FT                   SPAEVMAHLENDLGNAELVLRESLPADLVVRPGPISSAETP"
     atggaagaaa tactggatcg gattgcggga cttgggcccg ggcggcgggt gctggctgtc        60
     ctgggcgcac ccgggtcggg gaaatccacc ctggccgcgc agttggcggc ggggctcgac       120
     gatgcggtgc tggtgccgat ggacgggttc catctggaca accggctgct ggaggcggac       180
     gggcggcgcg gctgcaaggg cgcgcccgaa accttcgacg cggcagggtt cgtcgcgctg       240
     gtgcagcggt tgaaggcggg gggcgaggtg atccacccga tcttcgaccg cgcgctggac       300
     ctggccatcg ccggcgccgg ccgggtcgag gcagaaaccc ggctggtggt ggtcgagggc       360
     aattacctgc tgctggaccg cgacccctgg cgcgaactgg ccgggctttg ggacctgtcg       420
     gtcatgctgg acgtgccgat ggaggagttg cgacgccgcc tgaccgcccg ctggcagggg       480
     ctgggccgct cgcccgccga agtgatggcg catctggaaa acgacctcgg caatgccgaa       540
     ctggtgctgc gcgaatcgct gcccgccgat ctggtggtgc ggcccggacc tatttcttcg       600
     gccgaaacgc cttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page