(data stored in ACNUC7421 zone)

EMBL: CP000489.PE498

CP000489.PE498       Location/Qualifiers
FT   CDS_pept        complement(474658..475452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0503"
FT                   /product="ribose ABC transporter ATP-binding protein /
FT                   fructose ABC transporter ATP-binding protein / mannose ABC
FT                   transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02169 putative ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68615"
FT                   /db_xref="GOA:A1AZC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC1"
FT                   /protein_id="ABL68615.1"
FT                   /translation="MTANISGEPLLKARGLVKRYGKVTALDHCDFDLLPGEILAVIGDN
FT                   GAGKSSLIKALSGAVQPDEGEIALEGKPVRFANPLDARGYGIECVYQTLAMSPALSIAD
FT                   NMFMGRELRKPGIMGQWFRKLDRPAMEKFAREKLTELGLMTIQNINQAVETLSGGQRQG
FT                   VAVARAAAFGSKVVILDEPTAALGVKESRRVLELIRDVRSRGIPIILISHNMPHVFEVA
FT                   DRIHIHRLGRRLCVIRPDDYSMSDAVAFMTGAKLPEEAATAA"
     atgaccgcga acatttccgg ggaaccgctt ctgaaggccc gtggcctggt caagcgctat        60
     ggcaaggtca ccgcgctgga tcattgcgac ttcgacctgc tgccgggcga gatcctggcc       120
     gtcatcggcg acaacggcgc cggcaagtcc tcgctgatca aggcgctttc cggcgcggtc       180
     cagcccgacg agggcgagat cgcgctggag ggcaagccgg tgcgctttgc caacccgctg       240
     gatgcgcgcg gctatggcat cgaatgcgtc taccagacgc tggccatgtc gcctgccctt       300
     tccatcgccg acaacatgtt catggggcgc gaattgcgca agccgggcat catgggccag       360
     tggtttcgca agctggaccg cccggcgatg gagaagttcg cccgcgaaaa gctgaccgag       420
     ctggggctga tgacgatcca gaacatcaac caggcggtcg aaacgctttc cggcggccag       480
     cgccagggcg tcgcggtggc gcgggcggcc gccttcgggt caaaggtggt gatcctggac       540
     gagccgacgg cggcacttgg cgtcaaggaa agccgccgcg tgctggaact gatccgcgac       600
     gtgcgctcgc gcggcatccc gatcatcctg atcagccaca acatgccgca tgtcttcgag       660
     gtggcggacc gcatccatat ccaccggctg gggcggcggc tctgcgtgat ccggccggac       720
     gactattcca tgtcggacgc ggtggccttc atgaccggcg ccaagctgcc ggaagaggcg       780
     gcgacggcag cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page