(data stored in ACNUC7421 zone)

EMBL: CP000489.PE499

CP000489.PE499       Location/Qualifiers
FT   CDS_pept        complement(475449..476522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0504"
FT                   /product="fructose ABC transporter membrane protein /
FT                   mannose ABC transporter membrane protein / ribose ABC
FT                   transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_0989 ABC sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68616"
FT                   /db_xref="GOA:A1AZC2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC2"
FT                   /protein_id="ABL68616.1"
FT                   /translation="MSSDAKTAASYEEGLQGASDKVAEFQEQKTALKRLQHWLHMTPSA
FT                   VPMIVLVAAIVVFGLLSPNFFKAVTLSTILQQIAIVGILGCAQSLVVLTAGIDLSVGAI
FT                   AVFSSVLMGQFTFRYGIPAPLAIALGLAAGTAMGFANGWLVARIKLPPFIVTLGTWQII
FT                   LAANYIYSANETIRSSAIAAEAPALQFWGYSIQPGGVKILYAVFLMVALVALLAYVLRH
FT                   TAWGRHVYAVGDDPEAAELAGVRTKRVLIQVYVLAGLFCAIAGWVMIGRFGSVSPSAST
FT                   GQLGNIQSITAVVIGGISLFGGRGSIVGMFFGALIVGVFEMGLKMVGTDPQWTFFLIGL
FT                   LIILAVAVDQWIRKASA"
     atgtcatccg acgcaaagac ggccgccagc tacgaggagg gcctgcaagg cgcctcggac        60
     aaggttgccg agttccaaga acagaaaact gccctgaagc gcctgcaaca ttggttgcac       120
     atgacgccct cggcggtgcc gatgatcgtg ctggtcgcgg cgatcgtcgt cttcggcctg       180
     ctgtcgccga acttcttcaa ggcggtgacg ctgtccacca tcctgcaaca gatcgccatc       240
     gtcggcatcc tgggctgcgc gcagtcgctg gtggtgctga cggccgggat cgacctttcg       300
     gtcggcgcca tcgcggtgtt ttcctcggtg ctgatggggc agttcacctt tcgctacggc       360
     atcccggcgc cgcttgccat cgcgctgggg ctggcggcgg gcacggccat gggctttgcc       420
     aacggctggc tggtcgcccg catcaagctg ccacccttta tcgtgacgct gggcacctgg       480
     cagatcatcc tggcggcgaa ctacatctat tccgcgaacg agacgatccg ctcctcggcc       540
     atcgctgccg aggcgccggc gctgcaattc tggggctatt ccatccagcc cggaggggtg       600
     aagatcctct atgccgtctt cctgatggtc gcgctggtcg ccctgctcgc ctatgtcctg       660
     cgccataccg cctggggccg ccatgtctat gccgtgggcg acgacccgga agcggcggaa       720
     ctggccggcg tgcgcaccaa gcgggtgctg atccaggtct atgtgctggc cggacttttc       780
     tgcgccatag ccggctgggt gatgatcggc cgcttcggct cggtctcgcc ttcggcctcg       840
     accgggcagc tgggcaacat ccagtccatc accgccgtgg tgatcggggg gatcagcctg       900
     ttcggcgggc gcggctcgat cgtcggcatg ttcttcggcg cgctgatcgt cggcgtgttc       960
     gagatgggcc tcaagatggt cggcaccgat ccgcaatgga ccttcttcct catcggcctg      1020
     ctcatcatcc tcgccgtggc ggtggatcaa tggatcagaa aggcatcggc atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page