(data stored in ACNUC7421 zone)

EMBL: CP000489.PE5

CP000489.PE5         Location/Qualifiers
FT   CDS_pept        5157..5738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0005"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: rde:RD1_0431
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68122"
FT                   /db_xref="GOA:A1AXX8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXX8"
FT                   /protein_id="ABL68122.1"
FT                   /translation="MSVSRETERLATYAGLLRKWNPAINLIAASTIDQIEARHIADSLH
FT                   LVEIAKNAQGSWVDLGSGGGLPGIVVAIMRPDLELSMVESDQRKGAFLRNAIRELALPH
FT                   AKVLCKRIEALDRLDAANLSARALAPLPQLMAYVERHLSPSGTAWLMKGRNWQAEVSQA
FT                   QSDWKFDLKTHQSATDPDAAILEITGLRHA"
     atgagtgttt cacgtgaaac agaacgcctc gcgacttatg ccgggctgct gcggaaatgg        60
     aatccggcca tcaatctgat tgctgcttcg acaattgatc agatcgaggc gcgtcatatc       120
     gctgacagtt tgcatctggt cgagatcgcg aagaatgcac aaggaagctg ggtcgatctg       180
     ggcagcggtg gcgggcttcc cggcatcgtg gtcgcgatca tgcggcctga tctggagctg       240
     tccatggtgg aaagcgacca gcgcaagggg gcattcttgc gcaatgccat tcgcgagctg       300
     gcactgccgc acgcaaaggt gctgtgcaaa cgcatcgagg ctttggatcg gctcgatgcc       360
     gccaatctca gtgcaagagc ccttgctccg cttccgcagc tcatggcata tgtagagcgg       420
     cacctgagcc cgtctggaac agcatggctg atgaaaggcc gaaactggca agccgaggtt       480
     tctcaggcgc aaagcgattg gaagttcgac ctgaaaaccc accaaagcgc gacagatcct       540
     gacgcggcca ttctggaaat cacgggactc cgccatgcct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page