(data stored in ACNUC7421 zone)

EMBL: CP000489.PE50

CP000489.PE50        Location/Qualifiers
FT   CDS_pept        42298..43278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0050"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2277 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68167"
FT                   /db_xref="GOA:A1AY23"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY23"
FT                   /protein_id="ABL68167.1"
FT                   /translation="MEFLYASEVLLNGLMAGVMYSLVALGFVLIYKASGIFNYAQGVMA
FT                   LFAAMTLVGIMEGRVPFAHLINAAFGVHLSSFGWTVPGLLAILLTALIMVGLAIAIEKL
FT                   VLKHLVGQEPIILFMATIGLAWFLEGLGDVMWGADVKVLDVGLPQGISETVETMTDGLF
FT                   GYGFFIDRLDIWATVIAAVLVAALVGFSQYTKQGRAMRAVADDHQAALSVGISLQFIWI
FT                   MVWSIAGFVALVAGIMWGTKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIGMG
FT                   EKLFEYFVGPAVGGATENWFAYVLALLFLVFRPQGLFGERIIERV"
     atggaatttc tgtacgcaag cgaggtcctg ctgaacggcc tgatggccgg ggtgatgtat        60
     tcgctggtcg cgctgggctt cgtgctgatc tacaaggcct cgggcatctt caactatgcc       120
     cagggggtga tggcgctgtt cgcggccatg acgctggtcg gcatcatgga gggccgcgtg       180
     ccctttgcgc atctgatcaa cgcggccttc ggcgtgcatc tgtcgagctt cggctggacg       240
     gtgccggggc tgctggccat ccttctgacg gcgctgatca tggtcggcct tgccatcgcc       300
     atcgaaaagc tggtgctgaa gcacctggtc gggcaagagc cgatcatcct gttcatggcc       360
     accatcggcc tcgcctggtt tctcgagggg ctcggcgacg tgatgtgggg cgccgacgtg       420
     aaggtgctgg acgtgggcct gccgcagggc atttccgaga cggtcgagac gatgaccgac       480
     ggtttgttcg gctatggctt ctttatcgac cggctggaca tctgggcgac ggtgatcgcg       540
     gcggtgctgg tcgcggccct ggtcggcttc tcgcaatata ccaagcaggg ccgggcgatg       600
     cgcgcggtgg ccgacgacca ccaggcggcg ctttcggtgg gcatcagcct gcaattcatc       660
     tggatcatgg tctggtcgat cgccggcttc gtggcgctgg tcgcgggcat catgtggggc       720
     acgaagtcgg gggtgcagtt cagcctttcg ctgatcgcgc tcaaggcgct gccggtgctg       780
     atgctcgggg gcttcacctc gatccccggc gccatcgttg gcgggctgat catcggcatg       840
     ggcgagaagc tcttcgaata tttcgtcggc cccgcggtcg gcggcgcgac cgagaactgg       900
     ttcgcctatg tgctggcgct gctcttcctc gtcttccggc cgcagggcct gtttggcgag       960
     cgcatcatcg agcgggtgta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page