(data stored in ACNUC7421 zone)

EMBL: CP000489.PE502

CP000489.PE502       Location/Qualifiers
FT   CDS_pept        478963..479877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0507"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: sme:SMa0116 putative
FT                   DnaJ/CbpA-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68619"
FT                   /db_xref="GOA:A1AZC5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC5"
FT                   /protein_id="ABL68619.1"
FT                   /translation="MADDPYKALGLGKNASQDDIKKAYRRIAKTDHPDLNPDPAAHERF
FT                   KAASSAYDLLKDPEQRARFDRGEIDAQGQEQPQRHYYREYAESGDNPYRQHHGFDDLSD
FT                   VFSDLFGGRGGGGGGRRGGARSFDMRGSDQRFTLEIDFMTAARGGSTRITMPDGSVLEV
FT                   KIPEGAHDGQVIRLRGKGGPGMGNGEPGDALLTLIVAEDPDWHRDGNDVETTLPITIDE
FT                   AVLGGKVEAQTIDGPVMLTVPRGASSGRKLRLKGRGIKGADGRRGDQHVVLKIVMPPQI
FT                   DSELARFMEDWRQNHAYDPRRGK"
     atggccgacg atccatacaa ggcgctgggg ctgggcaaga acgccagcca ggacgacatc        60
     aagaaggcct atcgccggat cgccaagacc gaccacccgg acctgaatcc cgaccctgcc       120
     gcgcatgaac gcttcaaggc cgcttcctcg gcctatgacc tgctcaagga ccccgaacag       180
     cgtgcccgtt tcgaccgggg cgagatcgat gcccaggggc aggagcagcc gcagcggcat       240
     tactatcgcg aatatgccga atcgggcgac aacccttatc gccagcatca cggtttcgac       300
     gatctgtccg acgtgttctc ggacctgttc ggcgggcgcg gcggcggcgg tggagggcgg       360
     cgcggcggtg cgcgcagctt cgacatgcgc ggttccgacc agcgattcac gctggagatc       420
     gacttcatga ccgccgcgcg cggcggctcg acccggatca ccatgcccga cggcagcgtg       480
     ctggaggtca agatccccga gggcgcgcat gacggccagg tgatccggct gcgcggcaag       540
     ggcggccccg gcatgggcaa tggcgagccg ggcgatgcgc tgctgaccct gatcgtggcc       600
     gaggatcccg actggcaccg ggacggcaac gacgtggaaa ccacgctgcc catcaccatc       660
     gacgaggcgg tgctgggcgg caaggtcgag gcgcagacca tcgacggccc ggtcatgctg       720
     accgttccgc gcggcgccag ttccggccgc aagctgcgcc tgaaggggcg cggcatcaag       780
     ggcgcggacg ggcggcgcgg cgaccagcat gtcgtcttga agatcgtcat gccgccccag       840
     atcgacagcg aattggcgcg cttcatggag gactggcgcc agaaccatgc ctatgatccg       900
     aggaggggaa aatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page