(data stored in ACNUC7421 zone)

EMBL: CP000489.PE503

CP000489.PE503       Location/Qualifiers
FT   CDS_pept        479874..480221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rru:Rru_A2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC6"
FT                   /protein_id="ABL68620.1"
FT                   /translation="MTQPHYTLTQTLESVGGLTSEQLERYISAGVVVPVQSEQGPLFRE
FT                   IDLARLNLVVDLAEGYHLDEEALALVLSLVDQLHGLRGDMRAILDAVAREPVETRVRLK
FT                   AAIREVRVVTR"
     atgacccagc cccattacac cctgacccag acgctggagt cggtcggcgg cctgacgtcc        60
     gagcaactgg aacgctatat cagcgccggc gtcgtcgtgc cggtgcaatc cgaacagggt       120
     ccgctgtttc gcgagatcga cctggcgcgg ctgaacctgg tcgtcgatct ggccgagggc       180
     tatcatctcg acgaagaggc gctggccctg gtgctgtcgc tggtcgacca gttgcacggg       240
     ctgcgcggcg acatgcgggc gatcctggat gccgtggcgc gcgagccggt cgagacgcgg       300
     gtgcggctca aggcagcgat ccgcgaggtg cgggtggtga cgcgttaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page