(data stored in ACNUC7421 zone)

EMBL: CP000489.PE505

CP000489.PE505       Location/Qualifiers
FT   CDS_pept        complement(480382..480858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0510"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: rsp:RSP_2684
FT                   putative endonuclease involved in recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68622"
FT                   /db_xref="GOA:A1AZC8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZC8"
FT                   /protein_id="ABL68622.1"
FT                   /translation="MICENVETFAEALPRTGAVAGLDLGTKTIGVAVSDGLRGVASPLT
FT                   VIRRTKFTADAQALLKIVQDRALVGLVLGLPRNMDGSEGPRAQSTRAFARNLERLTPLP
FT                   ITFWDERLSTVAAERALLEGDTSRKRRAEVIDQVAAGYILQGALDRLRFLGRTE"
     atgatctgcg agaacgtcga aaccttcgcc gaggccctac cccgcaccgg cgccgtggcc        60
     gggctggacc tgggcaccaa gaccatcggc gtcgcggtca gcgacgggct gcgcggcgtc       120
     gcctcgccgc tgacggtgat ccggcgcacg aaattcaccg ccgatgcgca ggcgctgctg       180
     aaaatcgtgc aggaccgggc gctggtcggg ctggtgctgg gcctgccgcg caacatggac       240
     ggcagcgagg gaccgcgggc gcaatcgacc cgcgcctttg cccgtaacct ggagcggctg       300
     acgccgctgc cgatcacctt ctgggacgag cggctttcga cggtcgcggc cgaacgggcg       360
     ctgctggagg gggatacctc gcgcaagcgc cgcgccgagg tcatcgacca ggtggcggcc       420
     ggctatatcc tgcaaggcgc gctggaccgg ctgcgcttcc tgggccggac ggaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page