(data stored in ACNUC7421 zone)

EMBL: CP000489.PE51

CP000489.PE51        Location/Qualifiers
FT   CDS_pept        43354..44460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0051"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2276 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68168"
FT                   /db_xref="GOA:A1AY24"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY24"
FT                   /protein_id="ABL68168.1"
FT                   /translation="MSKRRSREGRMFYREAGDFKTSYRDDGQTFPIKLDRWGYYAILAV
FT                   AFLVVPLVIDSYWANAVLVPFLIYAIAALGLNILTGYAGQVSLGTGGFMAVGAYAVYKL
FT                   MVAFPGVPIVVHIILAGAITAVVGMLFGLPSLRIKGFYLAVATLAAQFFLVWLFNKVPW
FT                   FYNYSASGQINAPERTILGWAVTGPATSASAKYLICLCFAVGLAWMARNLTRGSVGRKW
FT                   MAIRDMDIAAEIIGVNPLTAKLSAFAVSSFFVGIAGALLFSVYLGAAEASEAFGINKSF
FT                   LVLFMIIIGGLGSIFGSFAGAAFLVLLPVLLKNVLVAQFGWPTDLAAHIELMIVGALIV
FT                   FFLIVEPHGLARLWALTKEKLRLWPFPH"
     atgtcgaaac gacgaagccg ggaggggcgg atgttctatc gtgaggcggg cgacttcaag        60
     acgagctatc gcgacgatgg ccagaccttt ccgatcaagc tggatcgctg gggatattac       120
     gcgatcctgg cggtggcgtt cctggtggtg ccactggtca tcgacagcta ttgggccaat       180
     gcggtcctgg tgcctttcct gatctatgcc atcgccgcgc tggggctgaa catcctgacc       240
     ggctatgccg ggcaggtcag cctgggcacc ggcggcttca tggcggtggg cgcctatgcg       300
     gtctacaagc tgatggtcgc ctttcccggc gtgccgatcg tcgtccacat catcctggcc       360
     ggagcgatca ccgccgtcgt cggcatgctc ttcggcctgc ccagcctgcg catcaagggc       420
     ttctacctgg ccgtggcgac gctggccgcg cagttctttc tggtgtggct gttcaacaag       480
     gtgccgtggt tctacaacta ctcggcctcg ggccagatca acgcgcccga acgcaccatc       540
     ctgggctggg cggtgaccgg gcccgccacc tcggcttcgg cgaaatacct gatctgcctg       600
     tgctttgccg tcgggctggc ctggatggcg cgcaacctga cccgcggtag cgtggggcgg       660
     aaatggatgg cgatccgcga catggacatc gcggccgaaa tcatcggggt gaacccgctg       720
     accgccaagc tgtcggcctt tgccgtctcc agcttcttcg tgggtatcgc cggggcactg       780
     ctgttctcgg tctatctggg tgcggccgag gccagcgaag ccttcggcat caacaagagc       840
     ttcctggtgc tgttcatgat catcatcggc gggctcggca gcatcttcgg cagctttgcc       900
     ggtgccgctt tcctggtgct gctgccggtc ctgctgaaga acgtgctggt ggcgcagttc       960
     ggctggccga ccgacctggc cgcccatatc gagttgatga tcgtcggcgc gctgatcgtg      1020
     ttcttcctga tcgtcgagcc gcacgggctg gcgcggctct gggcactgac gaaagagaag      1080
     ctgcggctct ggccgttccc gcattaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page