(data stored in ACNUC7421 zone)

EMBL: CP000489.PE511

CP000489.PE511       Location/Qualifiers
FT   CDS_pept        487599..488117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0516"
FT                   /product="Sarcosine oxidase, gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase, gamma subunit; KEGG:
FT                   rsp:RSP_2690 putative sarcosine oxidase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68628"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD4"
FT                   /protein_id="ABL68628.1"
FT                   /translation="MAEALARISQVQDWGMIQIRADLSRAGDAIAEAAGVALPGQGRIT
FT                   TDGSRTLGWMSPDELLLVLPRAETAEALAALQDALATEHALVLDVSDMRAVFRIQGAKA
FT                   LDVLMKLCPADLAAMPQDGLRRTRAAQVACGIWRETDGYVLIGFRSVTDYLRGILTGAA
FT                   VPGTQLDPR"
     atggctgagg cactggcaag gatctcgcag gtgcaggact ggggcatgat ccagatccgc        60
     gccgacctgt cacgcgcggg cgatgccatc gccgaggcgg caggggttgc gctgcccgga       120
     cagggccgca tcaccaccga cggcagccgg accctgggct ggatgtcgcc ggacgagctg       180
     ctgctggtgc tgccgcgggc cgagacggcc gaggcgctgg ccgcgttgca ggacgcgctt       240
     gcgaccgagc acgcgctggt gctggatgtc agcgacatgc gcgcggtgtt ccgcatccag       300
     ggcgccaagg cgctggacgt gctgatgaag ctgtgcccgg ccgatctggc ggcgatgccc       360
     caggacgggc tgcgccgcac ccgcgcggcg caggtcgcct gcggcatctg gcgcgagacg       420
     gacggctatg tgctgatcgg ctttcgctcg gtcaccgact acctgcgcgg catcctgacc       480
     ggcgcggcgg tgccgggcac gcagctcgac ccgcgctag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page