(data stored in ACNUC7421 zone)

EMBL: CP000489.PE515

CP000489.PE515       Location/Qualifiers
FT   CDS_pept        complement(489926..490564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0520"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   rsp:RSP_3601 lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68632"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD8"
FT                   /protein_id="ABL68632.1"
FT                   /translation="MMLRTLVLILALAAVPAAATPLRILAFGDSLTEGYGLPRKDGLVP
FT                   QLQDWLRARGHDVLVLNGGLSGDTTAGGRVRIGYSLARHKPDAVIVELGGNDLLMGFAP
FT                   QMVEGNLDSILGQAGRGGRPLLLVGIASPDHDDPLRRDWAGIWPRMATQHDALLMENLY
FT                   QPLFDLPGDGYKAMLQPDGLHASAKGVGLIVQSLGPKVEALIEKAEARR"
     atgatgctga gaacccttgt cctgatcctg gcccttgcgg ccgtgccggc ggcagcgacg        60
     ccgctgcgca tcttggcctt cggcgacagc ctgaccgaag gctacggcct gccccgcaag       120
     gacgggctgg tgccgcaatt gcaggactgg ctgagggcac gcggccatga cgtgctggtg       180
     ctgaacggcg ggctctcggg cgacaccaca gcgggcgggc gggtgcggat cggctattcg       240
     ctggcccgcc acaagcccga tgcggtgatc gtcgagctag gcggcaacga cctgctgatg       300
     ggctttgccc cgcagatggt cgagggcaac ctggattcga tcctgggcca ggccggcagg       360
     ggcggccggc cgctgctgct ggtcggcatc gcctcgcccg accacgacga ccccctgcgc       420
     cgcgactggg ccgggatctg gccgcgcatg gccacgcagc acgatgccct gctgatggag       480
     aacctgtacc agccgctttt cgacctgccg ggcgacggct acaaggccat gctgcaaccc       540
     gacgggctgc atgcctcggc caagggcgtc ggcctgatcg tgcaatcgct gggccccaag       600
     gtcgaggcgc tgatcgaaaa ggccgaagcc cgccgctaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page