(data stored in ACNUC7421 zone)

EMBL: CP000489.PE517

CP000489.PE517       Location/Qualifiers
FT   CDS_pept        493412..493990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0522"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mes:Meso_4112 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68634"
FT                   /db_xref="GOA:A1AZE0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE0"
FT                   /protein_id="ABL68634.1"
FT                   /translation="MNRRQMLMAALPLVAVPSLALAQAQPAALTTQAEPKRDPYAPTEV
FT                   SIRNDFEVGSIVVVSKDFFLYHVVAPGRAVRYGVAVGKAELVWKGRATVGRKTEWPSWT
FT                   PTPAMIKRNPGQYARWADGMPGGPTNPLGARALYLYDAKGNDTSIRIHGTTEPNSIGRA
FT                   VSNGCIRMRNEAVMDLFEQVPIGTPVYVY"
     atgaaccgca gacagatgct gatggccgcc ttgccgctgg tggccgtgcc ctcgctggcc        60
     ctggcacagg cgcagcccgc ggcgctgacc acgcaggccg agcccaagcg cgacccctat       120
     gccccgaccg aagtctcgat ccgcaacgat ttcgaggtcg gcagcatcgt cgtggtctcg       180
     aaggacttct tcctttacca cgtcgtcgca ccgggccggg cggtccgcta cggcgtcgcc       240
     gtcggcaagg ccgaactggt ctggaaaggc cgcgccaccg tcgggcgcaa gaccgaatgg       300
     cccagctgga cccccacgcc ggcgatgatc aagcgcaatc ccgggcaata tgcccgctgg       360
     gcggacggca tgccgggcgg cccgaccaac ccgctgggtg cgcgggcgct gtatctttac       420
     gacgccaagg gcaacgacac ctcgatccgc atccacggca cgaccgagcc gaactcgatc       480
     ggccgcgccg tctcgaacgg ctgcatccgc atgcgcaacg aggcggtgat ggacctgttc       540
     gagcaggtgc cgatcggcac gccggtttat gtctactaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page