(data stored in ACNUC7421 zone)

EMBL: CP000489.PE522

CP000489.PE522       Location/Qualifiers
FT   CDS_pept        complement(498015..499640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0527"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO0378 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68639"
FT                   /db_xref="GOA:A1AZE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE5"
FT                   /protein_id="ABL68639.1"
FT                   /translation="MPAAGALHGAPAIELRGISKAFGPVQANKDIDLVVPRGTIHGIIG
FT                   ENGAGKSTLMSILYGFYRPDAGEILIGGKPIAIADSQAAIRAGIGMVFQHFKLVQNFTV
FT                   LENVILGAEDGGLLRPSLSRARGALKRLASEYGLQVDPDALVEELSVGHQQRVEILKAL
FT                   YRQADILILDEPTGVLTPAEADHLFRILRGLRDEGKTIILITHKLREIMEITDNVSVMR
FT                   RGEMVASVKTAETGPAQLAELMVGRKVLLRVEKPPARPGAPVLEVRGLRMVDADGVERL
FT                   RGIDLEIRAGEILGIAGVAGNGQTQLLEVLGGFPEAGAKLQGEIRLNGKPLPLGGAGAD
FT                   GRARRQAGVGHVPEDRQAEGLIMDFTAWENVAFGYHHAPEFQNGMLMDNAAIRADAMGK
FT                   IQHFDIRPPNPDLAARNFSGGNQQKIVVAREVERNPDLLLIGQPTRGVDIGAIEFIHKR
FT                   IVALRDAGKAVLLVSVELDEIMALSDRIAVMFDGRIMGERLADEATTGDLGCLMAGVDP
FT                   ALTPPEAAIPPAAAPGTDAGGGAG"
     atgccggcgg ccggcgcgct gcacggggcc ccggcgatcg aattgcgcgg gatctccaag        60
     gctttcgggc cggtgcaggc caacaaagac atcgacctgg tcgtgccgcg cggcacgatc       120
     cacggcatca tcggcgagaa cggcgcgggg aaatcgacgc tgatgtcgat cctctacggt       180
     ttctatcgcc ccgatgccgg agagatcctg atcggcggca agcccatcgc catcgccgac       240
     agccaggccg cgatccgtgc cggcatcggc atggtgttcc agcatttcaa gctggtgcag       300
     aacttcaccg tgctggaaaa cgtgatcctg ggcgccgagg acggcgggct cttgcgccct       360
     tcgctgtccc gcgcgcgcgg cgcgttgaag cggctggcca gcgaatacgg gctgcaggtc       420
     gatcccgacg cgctggtcga ggaactgtcg gtcggccacc agcagcgggt cgagatcctg       480
     aaggcgctgt atcgccaggc cgacatcctg atccttgacg agccgaccgg cgtgctgacc       540
     ccggccgagg ccgatcacct gttccgaatc ctgcgcgggc tccgcgacga gggcaagacc       600
     atcatcctga tcacccacaa gctgcgcgag atcatggaga tcaccgacaa tgtctcggtc       660
     atgcggcggg gcgagatggt ggcctcggtc aagaccgccg agaccggccc cgcgcaactg       720
     gccgagctga tggtgggccg caaggtgctg ttgcgggtgg aaaagccgcc cgcccgcccc       780
     ggcgcgccgg tgctggaggt gcggggattg cggatggtcg atgccgacgg cgtcgagcgg       840
     ctgcgcggca tcgacctgga gatccgggcg ggcgagatcc tgggcatcgc cggggtggcc       900
     gggaacgggc agacgcagct gctggaggtt ctgggcggct ttcccgaggc aggggcgaag       960
     cttcagggcg agatccggct caacggcaag ccgctgccgc tgggcggcgc cggggccgac      1020
     ggtcgcgccc gccgccaggc cggcgtcggc catgtccccg aggaccggca ggccgagggg      1080
     ctgatcatgg atttcaccgc ctgggagaac gtcgccttcg gctatcacca cgcgccggag      1140
     ttccagaacg gcatgctgat ggacaatgcc gccatccgcg ccgatgcgat gggcaagatc      1200
     cagcatttcg acatccgccc gccgaacccg gaccttgccg ccaggaattt ctcgggcggc      1260
     aaccagcaga agatcgtggt ggcgcgcgag gtcgagcgca atcccgacct gctgctgatc      1320
     ggccagccga cgcgcggggt ggatatcggc gccatcgagt tcatccacaa gcgcatcgtc      1380
     gcgttgcgcg atgcgggcaa ggccgtgctg ctggtctcgg tcgagctcga cgagatcatg      1440
     gcgctgtcgg atcgcatcgc cgtcatgttc gacggccgca tcatgggcga acgcctggcc      1500
     gacgaggcga cgaccggcga tctgggctgc ctgatggccg gggtcgatcc cgccctgacg      1560
     ccgcccgagg cggcgatccc gccggcggcc gcgccgggga cggatgccgg cggcggtgcg      1620
     ggatga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page