(data stored in ACNUC7421 zone)

EMBL: CP000489.PE523

CP000489.PE523       Location/Qualifiers
FT   CDS_pept        complement(499640..500626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0528"
FT                   /product="nucleoside-binding protein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: rsp:RSP_2211
FT                   ABC transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68640"
FT                   /db_xref="GOA:A1AZE6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE6"
FT                   /protein_id="ABL68640.1"
FT                   /translation="MSLMKSLLAGACLTLLPVAALADPALIFDLGGKFDKSFNEAAYNG
FT                   AERWKAETGGTYKELEMQSEAQREQALRRLAQSGANPIVMTGFAFGEVLNKIAPDYPDT
FT                   KFVIIDMVVEQPNVQSVVFTEEQGSYLAGVAAAKASKSGTVGFIGGMDIPLIHKFECGY
FT                   AQGFKAANPDGKLIINYTGTTPAAWNDPVKGGELLKAQVSQGADVVYAAAGGTGIGVLQ
FT                   AAADAGVLSIGVDSNQNHLHPGMVLTSMVKGVDNSVYEAFKAGTEVEPGVRVMDLASGG
FT                   VSLAMDDNNKPLISDEIAAAIDTAAKAIDAGEIKVHDYMTDNTCPVQ"
     atgtccctga tgaaatccct gctcgccggc gcctgcctga ccttgctgcc cgtcgcagcc        60
     ctggccgatc cggcgctgat cttcgacctg ggcggcaagt tcgacaaatc cttcaacgag       120
     gcggcctata acggcgccga gcgctggaag gccgagaccg gcggcaccta caaggaactg       180
     gagatgcagt ccgaggcgca gcgcgaacag gccctgcgcc ggctggcgca gtcgggcgcc       240
     aatcccatcg tgatgaccgg ctttgccttc ggcgaggtgc tgaacaagat cgcgccggac       300
     tatcccgata cgaaattcgt gatcatcgac atggtggtcg aacagccgaa cgtgcaatcc       360
     gtcgtcttca ccgaggagca gggctcgtat ctggccggcg tggcggccgc caaggcctcg       420
     aaatccggca ccgtgggctt catcggcggc atggacatcc cgctgatcca caagttcgaa       480
     tgcggctatg cccagggctt caaggccgcc aacccggacg gcaagctcat catcaactat       540
     accggcacca cgccggccgc ctggaacgac ccggtgaagg ggggcgagct gctcaaggcg       600
     caggtctcgc agggggcgga cgtggtctac gccgcggcgg gcggcaccgg catcggcgtc       660
     ctgcaggcgg cggcggatgc cggcgtgctg tcgatcggcg tggacagcaa ccagaaccac       720
     ctgcatccgg gcatggtgct gacctcgatg gtcaagggcg tggacaattc cgtctatgag       780
     gccttcaagg ccgggaccga ggtcgagccg ggcgtccggg tcatggacct ggcctcgggc       840
     ggggtgtcgc tggccatgga cgacaacaac aagccgctga tctcggacga gatcgccgcc       900
     gccatcgaca ccgccgccaa ggccatcgac gcgggcgaga tcaaggtgca cgactacatg       960
     accgacaaca cctgcccggt gcagtaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page