(data stored in ACNUC7421 zone)

EMBL: CP000489.PE524

CP000489.PE524       Location/Qualifiers
FT   CDS_pept        complement(500718..501119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0529"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: rsp:RSP_2212 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68641"
FT                   /db_xref="GOA:A1AZE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE7"
FT                   /protein_id="ABL68641.1"
FT                   /translation="MTPDDLAALHDRCFATHPRPWSAAEFEALLAGPPNFLLTRPQGFL
FT                   LGRVIADEAELLTLAVAPEARRQGLASALLAEFAATSRARGAREAFLEVASDNAAAMAL
FT                   YARADWEIIGKRRNYYAPGVDAVLMRRTL"
     atgacccccg acgatctggc ggcactgcac gaccgctgct ttgccacgca tccccggccc        60
     tggtcggcag cggagttcga ggcgctgctg gccggcccgc cgaatttcct gctgacccgg       120
     ccgcagggct tcctgctggg ccgcgtcatc gcggacgagg ccgagttgct gacgctggcc       180
     gtcgcacccg aggcgcggcg gcaggggctg gcctcggcgc tgcttgccga attcgccgcc       240
     acgtcacggg cgcggggcgc gcgcgaggcc tttctggaag tcgcctcgga caatgcggcc       300
     gccatggcgc tttatgcccg cgcagactgg gaaatcattg gaaaacgacg gaattactac       360
     gcgcccggcg tggatgcggt gctgatgcgg cgcacgctct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page