(data stored in ACNUC7421 zone)

EMBL: CP000489.PE525

CP000489.PE525       Location/Qualifiers
FT   CDS_pept        complement(501116..501709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0530"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease; KEGG:
FT                   rsp:RSP_2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68642"
FT                   /db_xref="GOA:A1AZE8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE8"
FT                   /protein_id="ABL68642.1"
FT                   /translation="MADALSLGFDTSAAHCAAALLQGDRVLFHRHEEMARGQAERLFPL
FT                   LDEVLAAAGIGWRDLSVIGCGIGPGNFTGIRISVAAARGLSLSLGIPAIGVSVTEAAAH
FT                   GLPRPCRVAVPSRTGEVIWQDFGTGQATGPQQCASHDLPPGPAPLPPAMPLAEAIARFA
FT                   AARRDQPDLPRPAPIYLRPADAAPARDRGPLILS"
     ttggctgacg cgctctcgct gggcttcgac acatcggccg cgcattgcgc ggccgctttg        60
     ctgcaaggcg accgcgtcct gttccatcgc cacgaagaga tggcccgcgg ccaggcagag       120
     cggctgtttc cgctgcttga cgaggtgctg gccgcggcgg ggatcggctg gcgcgacctc       180
     tccgtcatcg gttgcggcat cgggcccggc aatttcaccg gcatccgcat ctcggtcgcg       240
     gcggcgcggg ggctgtcgct gtcgctgggc atccctgcca tcggcgtcag cgtgaccgag       300
     gccgccgcgc atggcctgcc ccgcccctgc cgcgtcgcgg tgccctcgcg cacgggagag       360
     gtgatctggc aggatttcgg caccgggcag gccaccggcc cgcagcaatg cgcttcgcat       420
     gacctgccgc ccggcccggc gcccctgccg ccggcaatgc ccttggccga ggccattgcc       480
     cgcttcgccg ccgcgcgtcg cgaccagcca gacctgccgc gtccggcgcc gatctacctg       540
     cgcccggccg acgccgcgcc ggcgcgcgac cgcggcccgt tgatcctgtc atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page