(data stored in ACNUC7421 zone)

EMBL: CP000489.PE530

CP000489.PE530       Location/Qualifiers
FT   CDS_pept        complement(504818..505792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68647"
FT                   /db_xref="GOA:A1AZF3"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF3"
FT                   /protein_id="ABL68647.1"
FT                   /translation="MAKRFGGRFSPQPRLDGTDPRPPARPAPGEIRHPLESRTRWVTIM
FT                   AIPFLISAFWQDPAGLALHLIAFGSIASGMWMTREGLQAEAAYDARRIARRPAIPRKLF
FT                   GGILTGLGLAIGSYVPGAEAGAGVIGVAGAMLHWLAFGSDPMRDKGMEGIDGVRQDRAQ
FT                   RIVAEGEAHLKAMQDAILRTGDRRLEARVGMFAAAARELFAHVEDNPDNIAALRRYLSV
FT                   YLQGARDATVKFADLYAQTRDPRARQDYETLLNDLEGEFAARRAKLLEGGRSDLDIEIS
FT                   VLRDRLAREGVRPQPTPSEPAELQRPMTLDDLLIPRESEKPRR"
     atggcaaagc gtttcggcgg ccgtttctcg ccccagcccc ggttggacgg aaccgacccg        60
     cgcccgcccg cgcgtcccgc accgggcgag atccggcatc cgctggaatc gcgcacccgc       120
     tgggtcacca tcatggcgat ccccttcctc atcagcgcct tctggcagga tccggccgga       180
     cttgccctgc atctgatcgc cttcggcagc atcgcctcgg gcatgtggat gacgcgcgag       240
     ggattgcagg ccgaagccgc ctatgacgcc cgccgcatcg cgcgtcgccc ggcgatcccg       300
     cgcaagctgt tcggcggcat cctgaccggg ctcggccttg ccatcggctc ctatgtcccg       360
     ggcgccgagg ccggtgccgg ggtgatcggc gtcgccggcg ccatgctgca ctggctggcc       420
     ttcggcagcg acccgatgcg cgacaagggc atggagggca tcgacggcgt ccgtcaggac       480
     cgcgcccagc gcatcgtcgc cgagggcgag gcgcatctga aggccatgca ggacgccatc       540
     ctgcgcaccg gcgaccgccg gctcgaggcc cgcgtgggca tgttcgctgc cgccgcgcgc       600
     gaacttttcg cccatgtcga ggacaatccc gacaatattg ccgccctgcg ccgctatctc       660
     agcgtctatc tgcagggcgc gcgcgatgcg acggtcaagt tcgccgatct ctatgcccag       720
     acccgcgacc cgcgcgcccg ccaggattac gagacgctgc tgaacgacct ggaaggcgaa       780
     ttcgccgccc gtcgcgccaa gctgctggag ggcggccgct cggatctgga catcgagatc       840
     agcgtgctgc gcgaccggct ggcgcgcgag ggggtgcgac ctcaacccac gccctccgag       900
     cccgccgaat tgcagcgccc gatgaccctc gacgacctgc tgatcccgcg cgaatccgaa       960
     aagccgcgcc gctag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page