(data stored in ACNUC7421 zone)

EMBL: CP000489.PE532

CP000489.PE532       Location/Qualifiers
FT   CDS_pept        complement(507708..508946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0537"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rsp:RSP_1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68649"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF5"
FT                   /protein_id="ABL68649.1"
FT                   /translation="MPREEAVPRLEQLKQERKVPGDSFLSAAEGRELTRIGAAAGTTIP
FT                   AAAETPAGNASTFPQGAAQEQAEPAAGDLAGEDAPAEPETAAEPAPAQFVLRLESTTDR
FT                   ARAEEMLAKWRETLPEAGLWTLPNGRLAIGFGPMDEATGTAWLKAFKDAGAVPKDAFLA
FT                   PGEDMGEIAIIGKVPDLGAPPAPDAASVPMPPLEDIQRALRWAGHYDGGIDGKDGPKTR
FT                   AAIAEEIVRLRASPDTATAMAELIRRREAWRAEMGLAELRDAHTGLALPAPMEKLQFDR
FT                   AERALSIYGPKDGSGAALILFSQPGGQQEMLDLAGLVTALGWVPAPERKVERGSVVLDG
FT                   RNQTHIGHAEGRVVDGRVQGFVLIWPISDPEGQHRLAAEISDNLARFAPGAGEAQPEAP
FT                   AIAPALAPTVAQD"
     atgccgcgcg aagaggcggt cccccggctg gagcagctga agcaggaacg caaggtgccg        60
     ggcgacagct tcctgtccgc cgccgagggg cgcgaactga cgcgcatcgg cgcagccgcg       120
     ggcaccacca tcccggcggc agcggaaacg ccggccggca atgcctcgac cttcccgcag       180
     ggcgccgccc aagagcaggc cgagccggcg gccggcgacc tggctggcga ggacgcacca       240
     gccgaacccg agaccgccgc cgagcccgcg ccggcacagt tcgtcttgcg cctggaatcc       300
     accacggacc gcgcccgggc cgaggaaatg ctggcgaaat ggcgcgaaac cctgcccgaa       360
     gccgggctgt ggaccctgcc gaacggccgg ctggccatcg gcttcggccc gatggacgag       420
     gcgaccggca ccgcctggct caaggcgttc aaggatgccg gcgcggtgcc caaggacgcc       480
     ttccttgcgc cgggcgagga catgggagag atcgcgatca tcggcaaggt gccggatctg       540
     ggcgcacccc ctgccccgga cgccgcatcg gtgcccatgc cgccgctgga ggacatccag       600
     cgcgcactgc gttgggccgg ccattacgac ggcggcatcg acggcaagga tggccccaag       660
     acccgcgccg ccattgccga ggagatcgtg cgcctgcgcg cctcgcccga taccgcgacc       720
     gccatggccg agctgatccg gcggcgcgag gcgtggcggg ccgagatggg gctggccgag       780
     ttgcgcgatg cccataccgg ccttgccctg cccgcgccga tggaaaagct gcaattcgac       840
     cgtgccgagc gcgcgctgtc gatctatgga cccaaggacg gctcgggcgc ggcgctgatc       900
     ctgttctcgc agcccggcgg ccagcaggag atgctggacc tcgccggcct cgtcaccgcg       960
     cttggctggg taccggcgcc cgagcgcaag gtggaacgcg gcagcgtcgt gctggatggc      1020
     aggaaccaga cccatatcgg ccatgccgag ggtcgggtgg tcgatggccg cgtgcagggc      1080
     ttcgtgctga tctggccgat ctcggacccc gagggccagc accggctggc ggccgagatc      1140
     tcggacaacc tggcccgctt tgcccccggc gcgggcgagg cgcagcccga ggcgcccgcc      1200
     atcgccccgg ccctcgcccc gaccgtcgcc caggactag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page