(data stored in ACNUC7421 zone)

EMBL: CP000489.PE533

CP000489.PE533       Location/Qualifiers
FT   CDS_pept        509237..510187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0538"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   rsp:RSP_1856 glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68650"
FT                   /db_xref="GOA:A1AZF6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZF6"
FT                   /protein_id="ABL68650.1"
FT                   /translation="MTSPKDNQTAKPVCFQDVILRLQSYWAAQGCAVLQPYDMEVGAGT
FT                   FHPATTLRSLGARPWAAAYVQPSRRPTDGRYGENPNRLQHYYQYQVIIKPSPPNLQELY
FT                   LGSLAAIGLDPMIHDVRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCR
FT                   PVSGELTYGLERLAMYVLGVEHVMDMPFNPPGSPIPLSYGDVFRQAEREYSRWNFEQAD
FT                   TGMLLQHFKDAEAECDRILTAAETDSAGRRIPMAHPAYDQAIKASHLFNLLDARGVISV
FT                   TERQAYIGRVRALAKRCADLFVTTEAATLQAEDAA"
     atgaccagcc caaaggacaa tcagacggcg aaacccgtct gctttcagga cgtgatcctg        60
     cgcctgcaat cctattgggc cgcgcagggc tgtgcggtgc tgcaacccta tgacatggag       120
     gtcggcgccg gcaccttcca cccggcgacc acgctgcgca gccttggggc ccggccctgg       180
     gccgcggcct atgtccagcc ctcgcgccgt ccgaccgacg gccgctatgg cgagaacccg       240
     aaccgcttgc agcattacta ccagtatcag gtcatcatca aaccctcgcc cccgaacctg       300
     caagagcttt acctgggcag tcttgcggcc atcggcctcg acccgatgat ccacgacgtg       360
     cgcttcgtcg aggacgactg ggaaagcccg acgctgggcg cctggggcct ggggtgggag       420
     gtctggtgcg acggcatgga ggtcagccag ttcacctatt tccagcaggt cggcgggcat       480
     gactgccgcc cggtctcggg cgagctgacc tatggcctgg agcgtctggc gatgtatgtg       540
     ctgggggtcg agcatgtgat ggacatgccc ttcaacccgc ccggcagccc gatcccgctg       600
     agctatggcg acgtcttccg ccaggccgag cgggaatatt cccgctggaa cttcgagcag       660
     gccgataccg ggatgctgct gcagcacttc aaggatgccg aggcggaatg cgatcgcatc       720
     ctgactgcgg ccgagacgga cagcgccggg cggcgcatcc cgatggcgca tccggcctat       780
     gaccaggcga tcaaggccag ccacctgttc aacctgctgg acgcgcgcgg cgtgatctcg       840
     gtcaccgaac gccaggccta tatcggccgc gtccgcgcgc tggcgaaacg ctgcgccgac       900
     ctgttcgtca ccaccgaggc cgccaccctg caagcggagg acgcagcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page