(data stored in ACNUC7421 zone)

EMBL: CP000489.PE534

CP000489.PE534       Location/Qualifiers
FT   CDS_pept        510184..510666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0539"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: sit:TM1040_2311 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68651"
FT                   /db_xref="GOA:A1AZF7"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF7"
FT                   /protein_id="ABL68651.1"
FT                   /translation="MSSGKIVASMLVLVAVMAGLAVWYLQVYGFYDQVDEISGAQDIVV
FT                   TDAQGATHPVAVADFKAIDATSSPIRYRACFTLDPAELADAAPYAGATPLNGPGWFKCY
FT                   SARALTADLESGAARAVLGQAEIRPDVDRVIVVYPDGRAFAWHQFNDKTPERGVMD"
     atgagctcgg gcaagatcgt cgcctcgatg ctggtgctgg tggcggtgat ggccggcctt        60
     gcggtctggt atctgcaggt ctacggcttc tacgatcagg tggacgagat cagcggcgcg       120
     caggacatcg tcgtcaccga tgcgcagggc gccacccatc cggtcgcggt cgcggatttc       180
     aaggccatcg acgcgacaag ctcgcccatc cgctatcgcg cctgcttcac gctggacccg       240
     gccgaactgg ccgatgccgc gccctatgcc ggtgcgacgc cgctgaacgg gccgggctgg       300
     ttcaagtgct attccgccag ggcgctgacc gccgacctgg aatcgggtgc ggcccgcgcc       360
     gtgctgggcc aggccgagat ccgccccgac gtggaccggg ttatcgtggt ctatcccgac       420
     ggccgcgcct ttgcctggca ccaattcaac gacaagaccc ccgaacgcgg agtgatggac       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page