(data stored in ACNUC7421 zone)

EMBL: CP000489.PE537

CP000489.PE537       Location/Qualifiers
FT   CDS_pept        515619..516158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0542"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: rsp:RSP_1860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68654"
FT                   /db_xref="GOA:A1AZG0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG0"
FT                   /protein_id="ABL68654.1"
FT                   /translation="MSISKSWLTRVSVCVAVALSPVAAVPAMADGQHQVAYETKKGRAA
FT                   RQATVQINPTDLQCLSEALYFEARGEGVQGQQAVAEVILNRVDHPRFPKTVCGVVNQRG
FT                   QFTYNKGARIREKGTYARVQKVAMAALAGAPRTLTNGATYFHTRAVRPSWSKRFERTTR
FT                   IGSHIFYRSDRRLASN"
     atgtcgatta gcaagtcatg gctgacgcgc gtttccgtgt gtgtggctgt cgctctttcg        60
     cctgtcgcag cagttccggc catggccgac gggcagcacc aggttgcata tgaaaccaag       120
     aagggacgcg ccgcccgcca ggcgaccgtc cagatcaacc ctaccgatct gcaatgcctg       180
     tccgaggcgc tgtatttcga ggcccgcggc gaaggcgtgc agggccagca ggccgtcgcc       240
     gaggtgatcc tgaaccgcgt cgatcatccg cgtttcccaa agaccgtctg cggcgtggtg       300
     aaccagcgtg gccagttcac ctataacaag ggcgcccgca tccgcgaaaa aggtacctat       360
     gcccgggtgc agaaggtcgc catggccgcc ctggccggcg ccccgcgcac gctgacgaac       420
     ggcgcgacct atttccatac ccgcgcggtc cggccctcgt ggtccaagcg gttcgagcgc       480
     acgacccgca tcggcagcca catcttctat cgttcggatc gccggctggc ctcgaactga       540
//

If you have problems or comments...

PBIL Back to PBIL home page