(data stored in ACNUC7421 zone)

EMBL: CP000489.PE541

CP000489.PE541       Location/Qualifiers
FT   CDS_pept        complement(519472..520593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0546"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: rsp:RSP_2656
FT                   putative salicylate hydroxylase (salicylate
FT                   1-monooxygenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68658"
FT                   /db_xref="GOA:A1AZG4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG4"
FT                   /protein_id="ABL68658.1"
FT                   /translation="MSGLKQHPVTIIGAGVAGLTAACALAQRGAQVTVLERAGALREVG
FT                   AGLQISPNAVRVLAALGLESRFQAISVPSERVELCDSVGRLVARLDLARHRPRDPFRLV
FT                   HRARLVALLEEAAREAGARIELGHEVADPPDVPLLIGADGVKSRLRPQLNGAETPFFTG
FT                   QTAWRALIPADPDAAPMVQVFMGPGRHLVSYPLGHGQRNIVAVVERPDWHEEGWSIPGD
FT                   PTELRAAFARFGGPVPGWLEQVREVGIWGLHRHPVAAHWQDGRRALIGDAAHPTLPFMA
FT                   QGAVMAIEDAWVLAACLDAGPDQQAALARFQALRQPRCQRIVEAANANARNYHLRGPTR
FT                   AVAHAGLRAVSRLAPARLIERFAWLYDYEPTAV"
     atgtccggcc tgaagcagca tcccgtcacc atcatcggcg caggcgtggc cggcctgacc        60
     gccgcctgcg cattggcgca gcgcggggcg caagtcacgg tgctggagcg cgcgggcgcc       120
     ctgcgcgagg tcggcgcggg cttgcagatt tcccccaatg cggtgcgggt gctggcggcg       180
     ctggggctgg aatcgcggtt ccaggcaatc tcggtcccct cggagcgggt cgagctttgc       240
     gattccgtcg gtcggcttgt cgcgcggctg gacttggcac gccaccgccc acgcgacccg       300
     ttccgccttg ttcaccgcgc ccggctggtc gcgctgctgg aggaagcggc gcgtgaagcc       360
     ggcgcccgca tcgagctggg ccatgaggtc gcggacccgc ccgatgtgcc gctgctgatc       420
     ggcgcggatg gcgtgaaaag ccgtttgcgc ccgcagctga acggcgccga gacacccttc       480
     ttcaccggcc agaccgcctg gcgcgccctg atcccggccg atcccgatgc cgcgcccatg       540
     gtgcaggtct tcatggggcc gggacggcac ctggtcagct atccgctggg ccacggccag       600
     cgcaacatcg tcgccgtcgt cgagcgcccc gactggcacg aagagggctg gtccatcccc       660
     ggcgacccca ccgagctgcg cgctgccttc gcccgtttcg gcggtcccgt gccgggctgg       720
     ctggaacagg ttcgggaggt cggcatctgg ggcctgcacc gccacccggt cgccgcgcat       780
     tggcaggacg gcaggcgggc gctgatcggc gatgccgcgc atcccaccct gcccttcatg       840
     gcgcaaggcg cggtcatggc gatcgaggat gcctgggtgc tggccgcatg ccttgacgcc       900
     ggtcccgacc agcaggcggc gctggcccgc ttccaggcgc tgcgccagcc gcgttgccag       960
     cgcatcgtcg aggcggccaa cgccaatgcc cgcaactatc acctgcgcgg cccgacccgc      1020
     gccgtcgccc atgccgggct gcgcgcggtt tctcgccttg ctcccgcccg gctgatcgag      1080
     cgtttcgcct ggctctacga ttacgagccg acggcggttt ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page