(data stored in ACNUC7421 zone)

EMBL: CP000489.PE543

CP000489.PE543       Location/Qualifiers
FT   CDS_pept        521219..522058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0548"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: rsp:RSP_2653 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68660"
FT                   /db_xref="GOA:A1AZG6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG6"
FT                   /protein_id="ABL68660.1"
FT                   /translation="MQFSSTETYVAPPDLAMAVNAAITLERPLLVKGEPGTGKTELARQ
FT                   VAASLDLPIVEWNVKSTTRAQQGLYEYDAVSRLRDSQLGEARVHDIANYIRKGKLWQAF
FT                   EAPGKVVLLIDEIDKADIEFPNDLLQELDRMEFHVYETGEMVQARHRPVVIITSNNEKE
FT                   LPDAFLRRCFFHYIRFPDAETLKRIVEVHYPGLKHRILDEALSQFLELREVQGLKKKPS
FT                   TSELLDWLKLILAEDLSPEDLKRPAGEMLPKLHGALLKNEQDVALFERLAFMARRQR"
     atgcagtttt cctcgaccga aacctatgtg gcgccccccg atctggccat ggccgtgaac        60
     gcggcgatca cgctggaacg gcccttgctg gtcaagggcg agccgggcac gggcaagacc       120
     gaactggcgc ggcaggtggc cgccagcctg gacctgccca tcgtcgaatg gaacgtgaaa       180
     tcgaccaccc gcgcgcagca ggggctttac gaatacgacg ccgtgtcgcg gctgcgcgac       240
     agccagctgg gcgaggcgcg ggttcacgat attgcgaact acatccgcaa gggcaagctg       300
     tggcaggctt tcgaggcgcc gggcaaggtc gtgttgctga tcgacgagat cgacaaggcc       360
     gatatcgaat tccccaacga cctgctgcag gaactcgacc gcatggagtt ccatgtctac       420
     gagaccggag agatggttca ggcgcggcac cggcccgtgg tcatcatcac ctcgaacaac       480
     gaaaaggaac tgccggacgc ctttctgcgc cgctgctttt tccactatat ccgctttccc       540
     gatgccgaga cgttgaagcg catcgtcgag gtgcattatc ccggcctgaa gcatcgcatc       600
     ctcgacgagg cgctgagcca gttcctggaa ctgcgcgagg tgcaggggct gaagaaaaag       660
     ccttcgacca gcgaacttct ggactggctc aagctgatcc tggccgagga tctgtcgccc       720
     gaggacctga agcgtccggc cggggagatg ctgccgaaac tgcacggcgc gctcttgaag       780
     aacgaacagg acgtggcgct gttcgagcgg ctggccttca tggcccgccg tcaacgctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page