(data stored in ACNUC7421 zone)

EMBL: CP000489.PE548

CP000489.PE548       Location/Qualifiers
FT   CDS_pept        complement(525037..525294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68665"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH1"
FT                   /protein_id="ABL68665.1"
FT                   /translation="MTQMIAHYSIADYARFRTAFDADAEDRGNNGLSLLQLWRENDQSA
FT                   WALFQVGDAAVARAYLEGAAGVFNSQAGVSATAFHFVETA"
     atgacgcaga tgatcgccca ttacagcatt gccgactatg cccgcttccg caccgccttc        60
     gacgctgatg ccgaggatcg cggcaataac ggcctgtcgc ttctgcaatt gtggcgcgag       120
     aacgaccaga gcgcctgggc gctgttccag gtcggggacg ccgctgtcgc gagggcctat       180
     ctggagggcg cggcgggcgt cttcaacagc caggccggcg tctcggccac cgccttccac       240
     ttcgtcgaga ccgcctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page