(data stored in ACNUC7421 zone)

EMBL: CP000489.PE550

CP000489.PE550       Location/Qualifiers
FT   CDS_pept        complement(526971..529937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0555"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: rsp:RSP_0965 2-oxoglutarate dehydrogenase E1
FT                   component (alpha-ketoglutarate dehydrogenase); TIGRFAM:
FT                   2-oxoglutarate dehydrogenase, E1 subunit; PFAM:
FT                   dehydrogenase, E1 component; Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68667"
FT                   /db_xref="GOA:A1AZH3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH3"
FT                   /protein_id="ABL68667.1"
FT                   /translation="MNDQSPNSAFHDSSFLQGHNAAYVEQLYGQWAQNPAAVDQAWDAF
FT                   FRSLGDDEAVVTREAKGASWHRADWPPVPADDTTAALTGEWPMLPKTEAKAALDKIAAK
FT                   AGEKGVNLTDDQLKRAVLDSVRAIMLIRAFRIRGHLHADLDPLGMREIPDHGELDPKTY
FT                   GFSEADLDRPIFIDNVLGLQIATIRQIVDLMSRTYCGTFALQFMHISNPEEAAWLKERI
FT                   EGYGKEIAFTREGRRAILNKLVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKR
FT                   GGALGVKDVVIGMPHRGRLSVLANVMGKPYRAIFHEFQGGSYKPDDVDGSGDVKYHLGA
FT                   SSDRTFDDNTVHLSLTANPSHLEAVNPVVLGKVRAKQDQLSDHTHRTAVLPILLHGDAA
FT                   FAGQGIVAECFQLSGIKGHRTGGCIHIVVNNQIGFTTAPHFSRTSPYPTDIALMVEAPI
FT                   FHVNGDDPEAVVHAARVATEFRQKFHKDVVIDIFCYRRFGHNEGDEPMFTNPAMYKAIK
FT                   GHKTTLQRYTERLVADGLVPEGEIEEMKAAFQSHLNEEFEVGKNFKPNKADWLDGKWSG
FT                   IEAEHAEENLGQTGIAPETMAEIGSALTRVPEGFDLHRTVGRLLESKKQMFETGKGFDW
FT                   ATGEALAFGSLLVEGHPVRLAGQDSTRGTFSQRHSAFVDQATEERCYPLNHIRGGQARY
FT                   EVIDSMLSEYAVLGFEYGYSLAEPNSLVMWEAQFGDFANGAQIMFDQFITSGEKKWLRM
FT                   SGLVMLMPHGYEGQGPEHSSARLERWLQMCAEDNWIVANCTTPANYFHILRRQLKRPFR
FT                   KPLVLMTPKSLLRHPLAVSTADEFLTGSTFNRVLVDDADRGKSEFKLAPDDKIRRVVIC
FT                   SGKVYYDLAQARDAAGAEDVYILRLEQFYPFPAQTMSKELERFKDAEIVWCQEEPKNQG
FT                   GWTFVEPNIEWVLSRIGAKHGRPRYVGRHAAASPATGLASRHKAEQEALVHEAITIGA"
     atgaacgatc aatcccccaa ctcggccttc cacgattcaa gcttcctgca aggccataac        60
     gcggcctatg tcgagcagct ttatggccaa tgggcccaga accccgcggc ggtcgatcag       120
     gcgtgggacg ccttcttccg cagcctgggc gatgacgagg ccgtggtcac ccgcgaggcc       180
     aagggcgcaa gctggcatcg tgccgactgg ccgccggtgc ccgcggacga caccaccgcg       240
     gcgctgaccg gcgaatggcc gatgctgccc aagaccgagg ccaaggctgc actggacaag       300
     atcgccgcca aggccggcga aaagggcgtg aacctgacgg acgatcagct caagcgcgcc       360
     gtgctggaca gcgtccgcgc catcatgctg atccgcgcct tccgcatccg cggccacctg       420
     catgccgacc tggacccgct gggcatgcgc gagatccccg accacggcga gctggacccc       480
     aagacctatg gcttctccga ggccgatctg gaccggccga tcttcatcga caacgtgctt       540
     ggcctgcaga tcgccacgat ccgccagatc gtggacctga tgagccgcac ctattgcggc       600
     accttcgcgc tgcaattcat gcatatctcg aaccccgagg aagccgcctg gctcaaggag       660
     cggatcgagg gctacggcaa ggagatcgcc tttacccgcg aggggcgccg cgccatcctg       720
     aacaagctgg tcgaggccga gggcttcgaa aagttcctgc atgtcaaata catgggcacc       780
     aagcgcttcg gccttgacgg cggcgaggcg ctgatcccgg cgatggagca gatcatcaag       840
     cgcggcggcg cgcttggcgt caaggacgtg gtgatcggca tgccgcatcg cggccgcctc       900
     tcggtcttgg ccaacgtcat gggcaagccc tatcgcgcca tcttccacga attccagggc       960
     ggcagctaca agcccgacga cgtggacggg tcgggcgacg tgaaatacca cctcggcgcc      1020
     tcgtcggacc gcaccttcga cgacaatacc gtgcacctgt ccctgactgc gaacccctcg      1080
     cacctcgagg ccgtgaaccc ggtggtgctg ggcaaggtcc gcgccaagca ggaccagctt      1140
     tccgaccaca cccaccgcac ggcagtgctg ccgatcctgc tgcatggcga cgcggccttt      1200
     gccggccagg ggatcgtggc ggaatgcttc cagctttccg gcatcaaggg tcaccgcacc      1260
     ggcggctgca tccatatcgt ggtgaacaac cagatcggct ttaccaccgc gccgcatttc      1320
     agccgcacct cgccctatcc gaccgacatc gcgctgatgg tcgaggcgcc gatcttccac      1380
     gtcaacggcg acgaccccga ggcggtggtg cacgccgccc gcgtcgcgac cgagttccgg      1440
     caaaagttcc acaaggacgt ggtcatcgac atcttctgct atcgccgctt cggtcacaac      1500
     gaaggcgacg agccgatgtt caccaacccg gcgatgtaca aggcgatcaa gggccacaag      1560
     accacgctgc aacgctatac cgagcggctg gtcgccgacg ggctggtccc cgagggcgag      1620
     atcgaggaga tgaaggccgc cttccagtcg cacctgaacg aagagttcga ggtcggcaaa      1680
     aacttcaagc cgaacaaggc cgactggctg gacggcaagt ggtcggggat cgaggccgag      1740
     catgccgagg aaaacctggg ccagaccggc atcgcgcccg agaccatggc cgagatcggc      1800
     agcgcgctga cccgggtgcc cgaaggcttc gacctgcaca ggaccgtggg ccggctgctg      1860
     gaatccaaga agcagatgtt cgagaccggc aagggcttcg actgggcgac gggcgaggcg      1920
     ctggccttcg gctcgctgct ggtcgagggt catccggtgc ggctggccgg ccaggattcg      1980
     acccgcggca ccttctcgca gcgccattcc gcctttgtcg atcaggccac cgaggaacgc      2040
     tgctacccgc tgaaccacat ccgcggcggg caggcgcgct acgaagtcat cgactcgatg      2100
     ctgtcggaat atgcggttct gggcttcgaa tacggctatt cgctggccga gccgaacagc      2160
     ctggtcatgt gggaagccca gttcggcgat ttcgccaacg gcgcccagat catgttcgac      2220
     cagttcatca cctcgggcga aaagaaatgg ctgcgcatgt ccggcctcgt catgctgatg      2280
     ccgcacggtt acgagggcca gggcccggag cacagctcgg cccggctgga acgctggcta      2340
     cagatgtgcg ccgaggacaa ctggatcgtg gcgaactgca ccacgccggc gaactatttc      2400
     cacatcctgc gccggcagct caagcgaccc ttccgcaagc cgctggtgct gatgacgccg      2460
     aaatcgctgc tgcgccaccc gctggccgtg tccacggcgg acgagttcct gaccggctcg      2520
     accttcaacc gggtgctggt ggacgatgcc gaccgcggca agtccgagtt caagctggcc      2580
     ccggacgaca agatccgccg cgtggtgatc tgctcgggca aggtctatta cgacctcgcg      2640
     caggcccgcg acgcggccgg cgccgaggat gtctatatcc tgcggctgga gcaattctat      2700
     cccttcccgg cccagaccat gtccaaggag ctggaacgct tcaaggacgc cgagatcgtc      2760
     tggtgccagg aggaacccaa gaatcagggc ggctggacct tcgtcgagcc caatatcgaa      2820
     tgggttctgt cgcgcatcgg cgccaagcat ggccggccgc gctatgtcgg acgccatgcg      2880
     gcggcctcgc cggccaccgg gcttgcctcg cgccacaagg ccgagcaaga ggccctggtc      2940
     cacgaagcga tcaccatcgg ggcctga                                          2967
//

If you have problems or comments...

PBIL Back to PBIL home page