(data stored in ACNUC7421 zone)

EMBL: CP000489.PE557

CP000489.PE557       Location/Qualifiers
FT   CDS_pept        537341..538075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0562"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rsp:RSP_0969 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68674"
FT                   /db_xref="GOA:A1AZI0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI0"
FT                   /protein_id="ABL68674.1"
FT                   /translation="MEMLGWVLAVIAAFSIGLAKGGLSMVGTISVPLLALVMSPVQAAG
FT                   ILLPVYIISDIGGLIAFRRDFDRRVLRTLVPGAITGIGLGWATAHHVDDAQVGLIVGVI
FT                   GLAFALNALLRSRVSASAKPPRWGAGSFWGTVSGYTSFVSHSGAAPYQVYAQPLRMTPM
FT                   TYAGTTTIFFAICNAVKLIPYAMLGQLSAHNLSVAAVLMVPGVLGVLAGLWLVRRMSPR
FT                   IFYGFITWALMLVSAQLIWDGI"
     atggagatgc tgggctgggt gctggcggtg atcgccgcct tttcgatcgg gctggccaag        60
     ggggggctgt ccatggtcgg caccatctcg gtcccgctgc tggcgctggt catgtcgccg       120
     gtgcaggcgg cgggcatcct gctgccggtc tatatcatct cggacatcgg cgggctcatc       180
     gcctttcgcc gcgatttcga tcgccgggtg ctgcggaccc tggtgccggg ggcgatcacc       240
     ggcatcgggc tgggctgggc cacggcgcat cacgtcgacg acgcgcaggt tgggctgatc       300
     gtgggcgtga tcggcctggc cttcgcactg aacgccctgc tgcgcagccg ggtcagcgcc       360
     agcgccaagc cgccgcgctg gggggcgggc agcttctggg gcacggtctc gggctatacc       420
     agcttcgtgt cgcattccgg ggcggcgccc tatcaggtct atgcccagcc cctgcgcatg       480
     acgccgatga cctatgccgg cacgacgacc atcttctttg ccatctgcaa tgcggtgaag       540
     ctgattccct atgccatgct gggccagctt tcggcgcata acctgtcggt ggccgcggtg       600
     ctgatggtgc ccggcgtgct gggcgtgctg gccgggttgt ggctggtcag gcgcatgtcg       660
     ccgcgaatct tctatggctt catcacctgg gcgctgatgc tggtttcggc ccagctgatc       720
     tgggacggga tctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page