(data stored in ACNUC7421 zone)

EMBL: CP000489.PE559

CP000489.PE559       Location/Qualifiers
FT   CDS_pept        539041..539592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0564"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: jan:Jann_0815 NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68676"
FT                   /db_xref="GOA:A1AZI2"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI2"
FT                   /protein_id="ABL68676.1"
FT                   /translation="MFILILGLALWWGAHLFKRLAPQRRAVMGDRGKGVVAGLLALSVV
FT                   LMVVGYRQADGPYWWGASAPLKGINNLLVLVAFYFFAADGMKTRITRHLRHPQLTGFAL
FT                   WAFAHLVPNGDLPSFVLFGGLLVWALVEMVVINRAQPDWTPPAGPFPARKEIMAVAGAV
FT                   VVLLVVGLIHAWLGYNPFGG"
     atgttcatcc tgatccttgg cctcgcactc tggtggggcg cgcatctgtt caagcgcctt        60
     gcgccgcagc gccgcgcggt catgggcgac cgtggcaagg gtgtcgtggc cggcctgctg       120
     gccttgtcgg tcgtgctgat ggtggtcggc tacaggcagg cggacggccc ctattggtgg       180
     ggcgcctcgg cgccgctcaa gggcatcaac aacctgctgg ttctggtggc cttctacttc       240
     ttcgcggccg acgggatgaa gacccggatc acccggcacc tccgccaccc gcaactgacc       300
     ggctttgccc tgtgggcctt tgcgcatctg gtgccgaacg gcgacctgcc cagtttcgtg       360
     ctgttcggcg ggctgctcgt ctgggcgctg gtcgagatgg tcgtcatcaa ccgcgcgcag       420
     ccggactgga cgccgcccgc cggccccttc ccggcgcgca aggagatcat ggcggtggcc       480
     ggcgccgtcg tcgtcctgct ggtggtcggg ctgatccacg cctggctcgg ctataacccg       540
     ttcggaggct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page