(data stored in ACNUC7421 zone)

EMBL: CP000489.PE560

CP000489.PE560       Location/Qualifiers
FT   CDS_pept        539594..539800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68677"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI3"
FT                   /protein_id="ABL68677.1"
FT                   /translation="MPKIYRLLTEDDTSAFCHKVSEALSKGWELHGGPAYAFDAARGVM
FT                   RCAQAVTKQIDADYHPEMKLGQQ"
     atgccgaaaa tctatcgcct gctgaccgag gacgacacct cggccttctg ccacaaggtc        60
     agcgaggcgc tgtccaaggg ctgggaactg cacggcggcc ccgcctacgc ctttgacgcg       120
     gcgcgcggcg tgatgcgctg cgcccaggcc gtcaccaagc agatcgatgc cgattaccac       180
     cccgagatga agctgggcca gcaatag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page