(data stored in ACNUC7421 zone)

EMBL: CP000489.PE562

CP000489.PE562       Location/Qualifiers
FT   CDS_pept        541157..541549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0567"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: rsp:RSP_0974 succinate dehydrogenase cytochrome b-556
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68679"
FT                   /db_xref="GOA:A1AZI5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI5"
FT                   /protein_id="ABL68679.1"
FT                   /translation="MADVNRGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLIT
FT                   WWLVAAVTSPGAFACADWVVRSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQ
FT                   AHKSSQALIAGSVVLAVLTLIVFFVF"
     atggctgacg tcaaccgggg caaccggcca ctgtcaccgc atttgcaggt ctatcgcctg        60
     ccacttgccg caatcacttc gatcatgacc cgtatcaccg gccacgccct ggtcgccggg       120
     atcgtgctga tcacctggtg gctggtcgct gccgtgacct cgcccggcgc cttcgcctgc       180
     gccgactggg tggtgcggtc ctggctgggc ttcatcatcc tgaccggctc gatgtgggcg       240
     ctgtggtatc acctgctcgc cgggctgcgc cacctgttct acgacgccgg ctacgggctg       300
     gagatcgagc aggcgcacaa gtcgagccag gcgctgatcg cgggttcggt cgtgctggcc       360
     gtgctgacgc tgatcgtctt tttcgtgttc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page