(data stored in ACNUC7421 zone)

EMBL: CP000489.PE563

CP000489.PE563       Location/Qualifiers
FT   CDS_pept        541566..541955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0568"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: rsp:RSP_0975 putative succinate dehydrogenase,
FT                   hydrophobic membrane anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68680"
FT                   /db_xref="GOA:A1AZI6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI6"
FT                   /protein_id="ABL68680.1"
FT                   /translation="MRYITPRKAAEGLGSAHEGTQHHWAMTVSAVALTVLTPLFMIVVA
FT                   RAIGLSQEQLLAYFGRPFPALITALFVIVGMVHFIKGTRIMIDDYFQGGTRKAAIIFSV
FT                   IFGWAVIAAAVYALARMGLGAIVVL"
     atgcgttaca tcaccccccg caaagccgcc gaaggcctgg gctcggccca cgaaggcacc        60
     cagcatcact gggccatgac cgtctcggcc gtggcgctga ccgtgctgac gccgctgttc       120
     atgatcgtcg tggcccgcgc catcggcctg tcgcaggaac agttgctggc ctatttcggc       180
     cgtcccttcc cggcgctcat caccgctctg ttcgtgatcg tgggcatggt ccacttcatc       240
     aagggcacgc ggatcatgat cgacgactat ttccagggtg gcacgcgcaa ggcggccatc       300
     atcttttccg tcatcttcgg ctgggcggtc atcgccgcag ccgtctatgc gctggcccgg       360
     atgggccttg gcgcgatcgt cgtcctctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page