(data stored in ACNUC7421 zone)

EMBL: CP000489.PE568

CP000489.PE568       Location/Qualifiers
FT   CDS_pept        545816..546649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68685"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ1"
FT                   /protein_id="ABL68685.1"
FT                   /translation="MTRIIPEDAVERRAVRPVICYLNETLPDPDLPGLQALRLTARKSG
FT                   ECLVPPREARCFHVPAGHFFRITSVEGPQVGDLNLWSAADPRERFYSGKTRALHGTHLT
FT                   RGDRMWSSFPNLRPMATVTEDTLEWYGIDEYGGSVHDVIGTRCDPYTHRLLSGQDYHHC
FT                   CHSNLTNALMAELSLARDEAEPLVHDVLNVFMCTGFTRDSGQYFMKASPVRPGDYIEFF
FT                   AEIDLIGGLSACPGGDCGSAHSSDAAACHPLLVEIFAPARSAARAQPGPSAYRWP"
     atgacccgca tcattcccga agacgccgtc gaacgccggg ctgtccgccc ggtcatctgc        60
     tatctgaacg agacgctgcc cgacccggac ctgccgggtt tgcaggcgtt gcggctgacc       120
     gcccgcaagt ccggcgaatg cctggtcccg ccgcgcgagg cgcgctgctt tcacgttccg       180
     gctgggcatt tctttcgcat caccagcgtc gagggaccgc aggttggcga cctgaacctg       240
     tggtccgctg ccgatccgcg cgagcggttc tattccggca agacccgggc attgcacggc       300
     acgcatctga cgcgcggcga ccgcatgtgg tcgagctttc ccaacctgcg cccgatggcc       360
     acggtgaccg aggacacgct ggaatggtat ggcatcgatg aatacggcgg ctcggtccat       420
     gacgtcatcg ggacgcgctg cgatccctat acgcatcgcc tgctgagcgg gcaggactat       480
     caccattgct gccattccaa cctgaccaat gcgctgatgg cggaactgag ccttgcccga       540
     gatgaggcag agcccttggt gcatgacgtg ctgaacgtct tcatgtgcac cggcttcacc       600
     cgcgattccg ggcagtattt catgaaggcg agcccggtgc gcccgggcga ctacatcgaa       660
     ttcttcgccg agatcgacct gatcggcggg ctctcggcct gtccgggcgg cgattgcggc       720
     agcgcgcatt ccagcgacgc cgccgcctgc cacccgctgc tggtcgagat attcgcgccg       780
     gcccggtccg cggcgcgtgc gcagccgggg ccgagcgcct atcgctggcc ctag             834
//

If you have problems or comments...

PBIL Back to PBIL home page