(data stored in ACNUC7421 zone)

EMBL: CP000489.PE571

CP000489.PE571       Location/Qualifiers
FT   CDS_pept        547754..549235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0576"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: sil:SPO2969
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68688"
FT                   /db_xref="GOA:A1AZJ4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ4"
FT                   /protein_id="ABL68688.1"
FT                   /translation="MSDLNKLTIAAARDGLRKGDFTSAELTETCLVAIEAAGALNAWCH
FT                   KTPEKAREMAAAADKRIAAGDAPAMCGIPLGIKDLFCTRDVPSQAASRILDGFLPQYES
FT                   TVTQNLWDAGAVMLGKLSMDEFAMGSSNESACYGPVVNPWKVDDRQLTPGGSSGGSAAA
FT                   VAADLCLAATGTDTGGSIRQPAAFTGTVGLKPTYGRVSRWGVIAFASSLDQAGPMTKTV
FT                   RDAAIMLGAMASVDAKDSTSAERAVPDYEAALTGDIRGRRIGIPREYRMEGMSDEIDAL
FT                   WHKAAEMLRDAGAEVVDITLPHTKYALPAYYVIAPAEASSNLARYDGVRYGRRARLGAG
FT                   DGVVEMYEKTRAEGFGPEVQRRVMIGTYVLSAGFYDAYYNRARKVRALIKRDFDQVFAD
FT                   GIDAILTPATPSAAFGLGEMSGKDPVEMYLNDVFTVTVNLAGLPGISVPVGLDRQGLPL
FT                   GMQLIGRPWDEGGLLNLAQSLESAAGFTAKPSRWW"
     atgagcgacc tgaacaaact gaccatcgcc gcagcccgcg acgggctgcg caagggcgat        60
     ttcaccagcg ctgaactgac cgagacctgc ctggtcgcca tcgaggctgc cggtgcgctg       120
     aacgcctggt gccacaagac cccggaaaag gcgcgcgaga tggcggccgc ggccgacaag       180
     cgcatcgccg cgggtgacgc gcccgccatg tgcggcattc cgctgggcat caaggatctg       240
     ttctgcaccc gcgacgtgcc gtcgcaggcg gccagccgca ttctcgacgg tttcctgccg       300
     caatatgaat cgaccgtgac ccagaacctg tgggatgcgg gcgcggtgat gctgggcaag       360
     ctcagcatgg acgaattcgc catgggttcg tcgaacgaaa gcgcctgcta tggcccggtg       420
     gtcaatccgt ggaaggtaga cgaccggcag ttgacgcctg gcggatcctc gggcggctcg       480
     gcggcggcgg tggcggccga cctgtgcctg gccgcgaccg gcacggatac cggcggctcg       540
     atccgccagc cggcggcctt taccggcacg gtcgggctga agccgaccta tggccgggtc       600
     agccgctggg gcgtgatcgc attcgccagc tcgctggatc aggccgggcc gatgaccaag       660
     acggtgcgcg acgcggcgat catgctgggc gccatggcct cggtcgatgc caaggattcg       720
     accagcgccg agcgcgcggt gccggattac gaggcggcgc tgaccggcga cattcgcggc       780
     cgtcgcatcg gcattccgcg cgaataccgc atggagggca tgtcggacga gatcgacgcg       840
     ctttggcaca aggcggccga gatgctgcgc gacgccggcg ccgaggtggt ggacatcacc       900
     ctgccgcata cgaaatacgc gctgccggcc tattacgtca tcgcgccggc cgaggcttcc       960
     tcgaacctcg cgcgctatga cggggtgcgc tatggccgcc gcgccaggct gggggcgggt      1020
     gacggcgtgg tcgagatgta tgaaaagacc cgtgccgagg gtttcggccc cgaggtgcag      1080
     cgccgggtga tgatcggaac ctatgtgctg tcggcgggct tttacgacgc ctattacaac      1140
     cgtgcccgca aggtccgcgc gctgatcaag cgcgacttcg accaggtctt tgccgacggt      1200
     atcgacgcca tcctgacgcc cgccaccccc agcgcagcct ttggcctggg agagatgtcg      1260
     ggcaaggatc cggtcgagat gtatctcaac gacgtcttta ccgtcacggt gaacctggct      1320
     gggttgccgg ggatttcggt gccggtgggg ctggaccgcc aaggtctgcc gctgggcatg      1380
     cagctgatcg gccgtccctg ggacgaaggc gggctcttga accttgcgca aagcctcgaa      1440
     tctgcggcag ggtttacggc gaaaccctcg cgctggtggt aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page