(data stored in ACNUC7421 zone)

EMBL: CP000489.PE574

CP000489.PE574       Location/Qualifiers
FT   CDS_pept        complement(550394..551167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0579"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   sil:SPO0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68691"
FT                   /db_xref="GOA:A1AZJ7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ7"
FT                   /protein_id="ABL68691.1"
FT                   /translation="MLSYQHAYHAGNLADLYKHALLASILAYLTAKPKPLSYLETHAGR
FT                   GLYDLSSPEADKTGEAAAGITRALAENWLPADHPLCLALDAVRARHGASAYPGSPLIAR
FT                   HFLRPGDVAHLAELHPAEHEALAEIAGFAHLHRQDGFQMAQAICPPTPRRGLLLIDPSY
FT                   EVKADYDAIPRQIAKLARKWNVGVIVLWYPILTDLRHAPMVEALRRNHPEALVSEVRFP
FT                   PARPGHGMVGSGMVVLNPPYGLAEEALRIEALYDR"
     atgttgtcct atcagcacgc ctatcacgcc gggaatctgg ccgacctgta caagcacgcg        60
     cttctcgcgt cgattctggc ttacctgacc gccaagccga agccgctgag ctacctggaa       120
     acccatgccg gccgcggcct ttacgacctg tcgtcgcccg aggccgacaa gaccggcgag       180
     gcggcggcgg gcatcacccg cgcccttgcc gaaaactggc tgccggccga tcatccgctg       240
     tgccttgcgc tggatgcggt gcgcgcccgc catggcgcct cggcctatcc cggatcaccg       300
     ttgatcgcac ggcatttcct gcgaccgggc gacgtggcgc atctggccga actgcacccg       360
     gccgagcacg aggctttggc cgagatcgcc ggctttgcgc atctgcaccg acaggacggc       420
     ttccagatgg cgcaggcaat ctgcccgccc accccgcgcc gggggctgct gctgatcgac       480
     cccagctatg aggtcaaggc cgattacgac gccatccccc gccaaatcgc caagctggcg       540
     cgcaaatgga acgtgggcgt gatcgtactg tggtatccga tcctgaccga ccttcgccat       600
     gcgccgatgg tcgaggcttt gcgccgcaac caccccgagg cactggtttc cgaagtgcgt       660
     ttcccgccgg cacggcccgg acatggcatg gtcggctcgg gcatggtcgt gctgaacccg       720
     ccctatggcc tggccgagga agccctgcga atcgaggcgc tctacgaccg atag             774
//

If you have problems or comments...

PBIL Back to PBIL home page