(data stored in ACNUC7421 zone)

EMBL: CP000489.PE575

CP000489.PE575       Location/Qualifiers
FT   CDS_pept        complement(551716..552015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0580"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   sit:TM1040_2023 protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68692"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ8"
FT                   /protein_id="ABL68692.1"
FT                   /translation="MFVSTARQGKPTAPSARRKRVYEMAVLDLIHGGMHRNDIAGNGAI
FT                   AKFVANVRENMARRAVYRQTLRELGELSNRDLADLGLNRGNIRSVAYEAAWGKK"
     atgttcgtct caacagcgcg acagggaaaa ccgaccgcgc catccgcaag acgaaaaaga        60
     gtgtatgaaa tggctgttct cgatctgatc catggcggta tgcaccgcaa cgacatcgcc       120
     ggcaacggcg cgatcgcgaa attcgtggcc aacgtccgtg agaacatggc ccgccgcgcg       180
     gtctatcgtc agaccctgcg cgaactgggc gaactgtcca accgcgatct ggccgatctg       240
     ggcctgaacc gcggcaatat ccgcagcgtg gcttacgaag ccgcctgggg aaagaagtaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page