(data stored in ACNUC7421 zone)

EMBL: CP000489.PE576

CP000489.PE576       Location/Qualifiers
FT   CDS_pept        552277..553380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0581"
FT                   /product="putative Mrp (multidrug resistance-associated
FT                   proteins) family protein"
FT                   /note="KEGG: rsp:RSP_2093 putative Mrp (multidrug
FT                   resistance-associated proteins) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68693"
FT                   /db_xref="GOA:A1AZJ9"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ9"
FT                   /protein_id="ABL68693.1"
FT                   /translation="MTISRERVLEELARIAVPGGGNLVSADLVRALSVESGVVRFVIEA
FT                   ADAAARSLGPVEAEAQRALSALPGVEKVQIVTTAPTVPRGAAPQVTARSGGEGAPPSLK
FT                   IGRHPTPQAGPAPVSGVARILAIGSGKGGVGKSTLTSNLAVALARKGRRVGLLDADIYG
FT                   PSQPRMLGLTGQRPTSDGQMIEPLHAHGVTVMSLGLMMKEGEAVVWRGPMLMGALQQML
FT                   NQVKWGELDVLLVDLPPGTGDVQLSLCQKAQVSGAIIVSTPQDVALIDARRAIDMFDKL
FT                   KTPVLGLVENMSTYICPNCGHEAHLFGHGGVAAEAAALGLPFLGEIPLNLDLRLSGDAG
FT                   TPIAAGDGPVAQSFARLAERLIDGGMA"
     atgacgatat cacgcgaacg tgtgcttgag gaacttgcgc ggatcgcagt tccggggggc        60
     ggaaacctgg tttccgccga tctggtgcgc gcgctcagcg tcgaatcggg cgtggtgcga       120
     ttcgtcatcg aggcggccga tgccgccgcc cgctctctcg gtccggtcga ggccgaggcg       180
     cagcgtgcgc tttcggccct gccgggggtc gagaaggtgc agatcgtcac caccgctccg       240
     accgtgccgc gcggcgcggc gccgcaggtg acggcgcgtt cgggcggcga gggggctccg       300
     cccagcctga agatcggccg ccacccgacg ccccaggcgg gaccggcccc ggtcagcggc       360
     gtggcgcgca tcctcgccat cggttcgggc aagggcgggg tcggcaaatc gacgctgacc       420
     tcgaacctcg cggtggcgct ggcgcgcaag gggcgccggg tcggcttgct ggatgccgat       480
     atatacggtc cctcgcagcc gcggatgctg ggcctgaccg ggcagcgccc gaccagcgac       540
     ggccagatga tcgagccgct gcacgcccat ggcgtcaccg tcatgtcgct gggcctgatg       600
     atgaaggaag gcgaggcggt ggtctggcgc ggcccgatgc tgatgggcgc gttgcagcag       660
     atgctcaacc aggtgaaatg gggcgagctg gacgtgctgc tggtcgacct gccgcccggc       720
     accggcgacg tgcagctgtc gctgtgccag aaggcgcagg tcagcggggc gatcatcgtc       780
     tcgaccccgc aggacgtggc gctgatcgac gcccgccgcg ccatcgacat gttcgacaag       840
     ctcaagaccc cggtgctggg gctggtcgaa aacatgtcca cctatatctg cccgaattgc       900
     ggccatgagg cgcatctgtt cggccatggc ggcgtcgccg ccgaggccgc ggcgctgggg       960
     ctgcctttcc tgggcgagat ccccctgaac ctcgacctgc ggctgtcggg cgatgcgggc      1020
     acgccgatcg cggccggcga cggcccggtg gcgcaatcct ttgcccggct ggccgagcgg      1080
     ctgatcgacg gcggcatggc ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page