(data stored in ACNUC7421 zone)

EMBL: CP000489.PE58

CP000489.PE58        Location/Qualifiers
FT   CDS_pept        50750..51301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0058"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sil:SPO3279 NUDIX
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68175"
FT                   /db_xref="GOA:A1AY31"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY31"
FT                   /protein_id="ABL68175.1"
FT                   /translation="MAGWAADGAGGHRGADRGDLAGAAAYLRQEPGRGATLDTRHQRQL
FT                   GFVGANLVLTHGAHLLTCLRDDYRWIRFPAHWDLPGGAAEPGETPVECALRELEEEFGL
FT                   RLSAGRLTGQPFVSVHAPPRASWLFCGTITAAEIAAIRFGDEGQEWRMMPIAEFVAHPR
FT                   AVPHFRDRVRLVLAGAGCGI"
     gtggccgggt gggctgccga tggcgctggt ggtcaccgcg gtgctgaccg gggtgatctg        60
     gctggtgctg cggcgtatct tcggcaggaa ccggggcgag gtgcgacact ggacacgcga       120
     catcaacgac aactaggctt tgtcggtgcc aatctggtgc tgacccatgg cgcgcatctg       180
     ctgacctgcc tgcgcgacga ttaccgctgg attcgctttc cggcgcattg ggacctgccg       240
     ggcggcgccg ccgaaccggg cgagacgccg gtcgaatgcg ccctgcgcga gcttgaggag       300
     gaattcgggc tgcggctttc cgccgggcgg ctgacgggac agcccttcgt ttcggtccac       360
     gctccgcccc gcgcttcgtg gctgttttgc ggcacgatca ccgccgcaga gatcgccgcg       420
     atccgctttg gcgacgaggg gcaggaatgg cggatgatgc cgattgcgga attcgtcgcc       480
     catccgcgcg ccgtgccgca tttccgggat cgggtgcggc tcgttcttgc cggagcgggc       540
     tgcgggattt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page