(data stored in ACNUC7421 zone)

EMBL: CP000489.PE581

CP000489.PE581       Location/Qualifiers
FT   CDS_pept        557715..559184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0586"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1182
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68698"
FT                   /db_xref="GOA:A1AZK4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK4"
FT                   /protein_id="ABL68698.1"
FT                   /translation="MRLSLLGLRGDKGRDPEVTGLAVDSRQVRPGHLFAALPGSATHGG
FT                   EFIQYALRQGAGAILTDRKGAEIAAAELVGADAALVVAEDPRAALAGAAALWFAAQPET
FT                   MVAVTGTSGKTSVASFTRQIWQALGHKAISLGTMGVQGDYQAKLAHTTPEPITLHRVLA
FT                   EAAAAGVTHAAMEASSHGLDQRRLDGVRLKAGAFTNFSQDHLDYHKDFDEYFAAKALLF
FT                   DHILEEGAGAVINIDDPRGRQMAQIAGERGLKLTTIGKDERADLRILGQRYDATGQDLR
FT                   FGFHGQAHLVRLALIGGFQAENVLAAAGLAIAAGDEAPRVIETLPGLTTVRGRMELAAV
FT                   RENGAAVFVDYSHKPGALASALQSLRPHVMGRIVVVFGAGGDRDRLKRPLMGEAARQFA
FT                   DVVYVTDDNPRSEDPAAIRAEVMAGAGPDAIEVGDRAEAILRGVDALQPGDALLIAGKG
FT                   HETGQIIGSDVYPFDDAEQASVAVAALDGKI"
     atgcggctgt cccttttggg gcttaggggg gacaaggggc gcgaccccga ggtgacgggc        60
     cttgccgtcg attcgcggca ggtcaggccg ggccatctgt tcgcggcact gccgggctcg       120
     gccacgcatg ggggcgagtt catccaatac gcgctgcgcc agggcgccgg cgcgatcctg       180
     accgaccgca agggcgccga gatcgcggcg gccgagcttg tcggtgccga tgccgcgctg       240
     gtcgtggccg aggacccgcg cgcagcactg gccggcgctg ccgccttgtg gttcgcggcc       300
     cagcccgaga cgatggtcgc cgtcaccggc acttccggca agacctcggt cgccagtttc       360
     acacggcaga tctggcaggc gctgggccac aaggcgatca gcctgggcac catgggcgtg       420
     cagggcgact atcaggccaa gcttgcccat accacgcccg agccgatcac cctgcatcgc       480
     gtgctggccg aggccgccgc tgcgggcgtc acccatgcgg cgatggaggc cagttcgcac       540
     gggctggacc agcgccgtct ggacggggtg cggctgaagg ccggcgcctt caccaatttc       600
     agccaggacc acctggacta ccacaaggat ttcgacgaat atttcgccgc caaggcactg       660
     cttttcgacc atatccttga agaaggcgcc ggggcggtca tcaatatcga cgatcctcgc       720
     ggccggcaga tggcgcagat cgcgggcgag cgtggcctga agctgaccac catcggcaag       780
     gacgaacggg cggacctgcg catcctcggc cagcgctatg acgcgaccgg gcaggatctg       840
     cgcttcggct tccacgggca ggcgcatctg gtgcggctgg cgctgatcgg cggtttccag       900
     gcggaaaacg tgctcgccgc ggccggcctt gccatcgccg ccggggacga ggcgccccgg       960
     gtgatcgaga ccttgccggg cctgaccacc gtgcgcggtc gcatggaact ggccgcggtg      1020
     cgggaaaacg gcgcggcggt cttcgtcgat tacagccaca agcccggcgc gctggcctcg      1080
     gccctgcaat cgctgcgccc gcatgtcatg ggccgcatcg tcgtggtctt cggcgccggc      1140
     ggcgatcgcg accggctcaa gcgcccgctg atgggcgagg cggcgcggca attcgccgat      1200
     gtggtctatg tgaccgacga caacccccgc tccgaggatc cggctgcgat tcgtgccgag      1260
     gtcatggccg gcgctggtcc cgacgccatc gaggtcggcg accgcgccga ggcgatcctg      1320
     cgcggcgtcg atgccctgca accgggcgat gcgctgctga tcgccggcaa ggggcacgag      1380
     accggccaga tcatcggcag cgacgtttac cccttcgacg atgccgagca ggcctcggtg      1440
     gccgtcgcgg cattggatgg caagatatga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page