(data stored in ACNUC7421 zone)

EMBL: CP000489.PE582

CP000489.PE582       Location/Qualifiers
FT   CDS_pept        559181..560566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0587"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1183
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68699"
FT                   /db_xref="GOA:A1AZK5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK5"
FT                   /protein_id="ABL68699.1"
FT                   /translation="MTLWTSQDAAEATGGRATRDFAVGGVSIDTRTIRPGDLFVALQAA
FT                   RDGHDFVARALEKGACAALVSRIPEGVAPDAPLLVVPDVLPALEALGRAGRARMRGKVV
FT                   AITGSVGKTSTKEMARVALAGQGRVHAAEASYNNHWGVPLTLARMPEDTDFAIVEIGMN
FT                   HPGEIEPLARLARPHVAMVTTVAAAHLEAFGAIEGIAREKGAIFRGLIQPGTAIIPEDL
FT                   PVTQLLRDCADDAAAIVIGFGQQGMARPLKAETLDGVTRVRARVLGETVDFMLASAGTH
FT                   FVMNAVGMLAALSAAGADVAEAAKHLSDWRPPLGRGAVEDLDGIRLIDDAYNSNPTSLS
FT                   AGLATLARLTGGRRVAILGDMLELGPDEIALHAGMAGDPAMEAVDLVHTAGPRMRALHE
FT                   ALPQGRRGMHAETAAELAGKVGELVASGDIVLVKGSKSSKVSTVVDALRRTRQSTPPGE
FT                   RTA"
     atgacgctct ggacctcgca ggatgccgcc gaggccaccg gcggccgtgc cacccgtgat        60
     ttcgcggtcg gcggcgtttc catcgacacc cgcaccatcc ggccgggcga cctgtttgtc       120
     gccctgcaag ccgcccgcga cggccatgac ttcgtcgccc gggcgctcga gaagggtgcc       180
     tgcgccgcgc tggtcagccg catccccgaa ggcgtggcgc cggatgcgcc actgctggtc       240
     gtccccgatg tcctgccggc actggaggcc ttgggccgcg ccggtcgcgc ccggatgcgg       300
     ggcaaggtcg tcgccatcac cggctcggtc ggcaagacct cgaccaagga gatggcccgc       360
     gtcgccctgg ccgggcaggg cagggtccac gcggccgagg ccagctacaa caaccattgg       420
     ggcgtgcccc tgacgctggc gcgcatgccc gaggacaccg acttcgccat tgtcgagatc       480
     ggcatgaacc atccgggcga gatcgagccc cttgcccgcc ttgcccgccc gcatgtcgcc       540
     atggtcacca ccgttgccgc cgcgcatctg gaagccttcg gcgccatcga gggcatcgcc       600
     cgcgaaaagg gcgcgatctt tcgcggtctg atccagcccg gcaccgccat catccccgag       660
     gatctgcccg tcacgcaact gctgcgcgac tgtgccgacg atgccgccgc catcgtgatc       720
     ggcttcggcc agcagggcat ggccaggccg ctcaaggccg agaccctgga cggcgtgacc       780
     cgggtccgcg ctcgcgtgct gggcgagacg gtggatttca tgctcgccag cgccggcacg       840
     catttcgtga tgaacgcggt cggcatgctg gccgcgcttt ccgccgccgg ggcggatgtg       900
     gccgaggcgg cgaagcacct gtccgactgg cgcccgccgc tgggtcgcgg cgccgtcgag       960
     gatctggacg gcatccggct gatcgacgat gcctacaact ccaatccgac ctcgctttcc      1020
     gccggcctcg cgacgctggc gcggctgacc ggcgggcgcc gggtggcgat cctgggggac      1080
     atgctggaac tcggcccgga cgagatcgcg ctccatgccg gcatggccgg ggaccccgcg      1140
     atggaagccg tcgacctggt ccataccgcc ggcccgcgca tgcgcgccct gcacgaggcg      1200
     ctgccgcaag gccggcgcgg aatgcatgcc gagacggccg ccgaactggc cgggaaagta      1260
     ggcgaactgg tcgcgtccgg cgatatcgtg ctcgtgaagg gttcgaagtc ctccaaggtc      1320
     tcgacggtgg ttgacgcgct gcggcgaacg cgccaaagca cgccccctgg cgaaaggaca      1380
     gcgtaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page