(data stored in ACNUC7421 zone)

EMBL: CP000489.PE589

CP000489.PE589       Location/Qualifiers
FT   CDS_pept        568349..569500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0594"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: rsp:RSP_0455
FT                   possible NOL1/NOP2/sun family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68706"
FT                   /db_xref="GOA:A1AZL2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL2"
FT                   /protein_id="ABL68706.1"
FT                   /translation="MTPAARAAAAIDILDRILDGQAAEAALIRWARASRFAGSGDRAAV
FT                   RDLVFDALRRLRSRAALGGALSGRGLLLGMCREEGIDPATLFTGEGHAPSVLSEGEGQA
FT                   GRAPTPDEALDLPDWLLPLWRKALGGDAEPVALAMRDRAPVWLRVNLRRADPARAAAAM
FT                   AEQGIATAPHPDLPTALRITEGARRLAGCHAYREGLVELQDLSPQMACALLPAQGSLLD
FT                   FCAGGGGKALALAAQGAGPVTAHDIDAGRMADLPARAERAGVRIRLAAPGKVAGRFDTV
FT                   VADVPCSGSGTWRRGPDAKWRLTRDDLEQLAARQCRILDQAAGFVADGGHLAYMTCSVL
FT                   DAENDDQVQGFLARNRRFEQVLARRFTPLTASDGFYLALMRRR"
     atgacgcccg ccgcccgtgc cgccgcggcc atcgacattc ttgaccgcat tctcgacggg        60
     caggccgccg aagcggcgct gatccgctgg gcacgggcca gccgctttgc cggctccggc       120
     gaccgcgcgg cggtgcggga cctggtcttc gacgccttgc gccgattgcg ttcgcgtgcc       180
     gccctgggcg gcgcgctctc cgggcgcggg ctgctgctgg gcatgtgccg cgaagagggg       240
     atcgaccccg caaccctgtt caccggtgaa gggcacgcgc cctcggtgct ttccgagggc       300
     gagggtcagg ctggccgtgc gcccacgccg gacgaggcgc tggatctgcc cgactggctc       360
     ttgccgcttt ggcgcaaggc gcttggcggg gatgccgagc ccgtggcact ggccatgcgg       420
     gatcgcgcgc cggtctggct gcgcgtcaac ctgcgccgtg ccgatccggc ccgtgccgcc       480
     gccgcgatgg ccgagcaggg gatcgccacc gcaccccatc ccgatttgcc gacggccctg       540
     cgcatcaccg agggcgcccg gcggctggcc ggctgccatg cctatcgcga ggggctggtc       600
     gaattgcagg atctttcgcc ccagatggcc tgcgcgctgc tgccggcgca aggcagcctg       660
     ctggatttct gcgccggtgg cggcggcaag gcgctggcgc ttgccgcgca gggtgcgggg       720
     ccggtcaccg cgcatgacat cgatgcgggg cgcatggccg atctgcccgc acgcgccgaa       780
     agggcagggg tgcgcatccg tcttgcggcg ccgggcaagg ttgcgggccg gttcgatacg       840
     gtcgttgccg acgtgccctg ttcgggcagc ggaacctggc ggcgcggccc ggatgcgaaa       900
     tggcgcctga cgcgcgacga tctggagcag cttgcggccc ggcagtgccg gattctggat       960
     caggcggcgg ggttcgtcgc cgatggcggg catctggcct atatgacctg ctcggtcctg      1020
     gatgccgaga acgacgatca ggtgcaaggt tttctggcgc gaaaccggcg gttcgagcag      1080
     gtcctggcgc ggcgttttac accgctgacc gcctcggacg gcttttatct ggccctgatg      1140
     cgccgccgtt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page