(data stored in ACNUC7421 zone)

EMBL: CP000489.PE59

CP000489.PE59        Location/Qualifiers
FT   CDS_pept        51353..51982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0059"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: bpe:BP1270 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68176"
FT                   /db_xref="GOA:A1AY32"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY32"
FT                   /protein_id="ABL68176.1"
FT                   /translation="MSRMQLYRRNGWGSAIVEAQLAHYGLEAEGVEVADLFLDSAARRE
FT                   LMRISPAGQIPVLILPDGRVLSESAAITLHLADMTERDDLVPAAGAAERPRFLRWLIFL
FT                   VAQVYPCFTFGDDPARFLTDPAAQKELGEATTARLQELWTALEGAVGAPWFLGERFSAL
FT                   DIYLAVMTNWKPGPEWFEAHAPKVWSIARATVARDDLAPVFQRNFG"
     atgtctcgga tgcagctata tcgccgcaac ggctggggct cggccatcgt cgaggcgcag        60
     ctggcgcatt acgggcttga ggccgagggg gtcgaggtcg cggacctgtt cctcgattcg       120
     gctgcaaggc gcgagctgat gcggatcagc cccgcggggc agattccggt gctgatcctg       180
     cccgacgggc gggtgctgtc ggaaagcgcg gcgatcacgc tgcacctggc cgacatgacc       240
     gagcgggacg atctggtgcc ggccgccgga gccgccgagc ggccgcgatt cctgcgctgg       300
     ctgatctttc tggtcgcgca ggtctatccc tgctttacct tcggcgacga tccggcgcgg       360
     ttcctgaccg atccggcagc gcagaaggaa ctgggcgagg ccaccacggc acggctgcaa       420
     gagctttgga ccgcgctgga gggcgcggtg ggcgcgccgt ggttcctggg cgagcgcttc       480
     tcggcgctgg acatctatct ggcggtgatg accaactgga aacccggccc ggaatggttc       540
     gaggcccatg cgcccaaggt ctggtccatc gcccgcgcca cggtggcgcg ggacgatctg       600
     gcgccggtct tccagcgcaa tttcggctga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page