(data stored in ACNUC7421 zone)

EMBL: CP000489.PE591

CP000489.PE591       Location/Qualifiers
FT   CDS_pept        complement(571624..572208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68708"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL4"
FT                   /protein_id="ABL68708.1"
FT                   /translation="MLIFWERRLVFLATPKAGSTAVETALEALASVVVQRPAELKHADL
FT                   RTYRHHIEPWLRSVTGEKFTTIALMREPIGWLRSWYRFRLRDDDEDPNHAMIGLSFADF
FT                   AQAYADPGGPDVARVGAQADFLTAEVDRVDCIFRYEDMDAFTHFLEDRLDCEISLPRVN
FT                   VPPAVDVSLNPEQEGSLRKIMARDFALYASL"
     atgctgatat tctgggaaag acggctggtt ttcctcgcga cgccgaaagc cggctccacc        60
     gctgtcgaaa ccgcgctaga ggcccttgcc agtgtcgtcg tccagcgccc ggccgagttg       120
     aagcatgccg atctgcgcac ctaccggcac catatcgaac cctggttgcg ctcggtcacc       180
     ggcgagaaat tcaccaccat cgccctgatg cgcgaaccga tcggatggct tcgcagctgg       240
     tatcgctttc gcctgcgcga cgatgacgaa gacccgaacc acgccatgat cggcctcagc       300
     ttcgcggatt tcgcgcaagc ctatgccgat cccggcggcc cggacgtcgc gcgcgtcggc       360
     gcacaggcgg atttcctgac cgcggaagtc gatcgtgtcg attgcatctt tcgctacgag       420
     gacatggatg cctttaccca tttcctcgag gatcggctgg attgcgagat cagcctgcca       480
     cgcgtcaacg tcccgcccgc cgtcgatgtc agcctgaacc ccgagcagga aggttcgctg       540
     cgcaagatca tggcgcggga cttcgcactt tacgcttcgc tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page