(data stored in ACNUC7421 zone)

EMBL: CP000489.PE601

CP000489.PE601       Location/Qualifiers
FT   CDS_pept        complement(580824..581795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0606"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sil:SPO2816
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68718"
FT                   /db_xref="GOA:A1AZM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM4"
FT                   /protein_id="ABL68718.1"
FT                   /translation="MTDRLLIEESAVNAPAPGAEALPPADPPPQAPARSQWRDIWRQFR
FT                   NHRGAMLALVLFVAILLFVGLGPLVWTIDPGFVDIRARNQGFSAAHPLGTDQLGRDMLA
FT                   RLMAGGQVSLAVGLTAMAVALTLGSLIGISSGYFRRLDAPLMRLTELFLALPLLPLLLL
FT                   MVTLFREPLGRAMGPAGGTFLLIVSAIGITSWMQTARILRGEVLGLKEREFILAAQSIG
FT                   TPAPRMILRHVLPNVISPIVVAATLGIATAIITESALSFLGLGFPPDFPTWGRLLYDAV
FT                   DQMQMYPWRVVLPGLLISLTVLSVNYIGDGLRDAMDPRIRGR"
     atgactgacc ggctgctcat cgaggaaagc gccgtcaatg cccccgcccc gggggccgag        60
     gcgctgccgc ccgccgatcc tccgccccag gcgcccgccc gcagccagtg gcgcgacatc       120
     tggcggcagt tccgcaacca tcgcggcgcc atgctggcgc tggtgctgtt cgtggcgatc       180
     ctgctgttcg tcgggctcgg gccgctggtc tggaccatcg atccgggttt cgtcgatatc       240
     cgtgcccgca accagggttt cagtgcggcg catcccctgg gcaccgacca gcttggccgc       300
     gacatgctgg cgcggctgat ggccggaggg caggtttcgc tggcggtcgg gctgaccgcc       360
     atggccgtcg cgctgacact gggcagcctg atcggcatca gctcgggcta tttccgccgg       420
     ctggacgcgc cgctgatgcg gctgaccgag ctgttcctgg ccctgccgct gctgcccctg       480
     ctgctgctga tggtgacatt gttccgcgag cccctgggcc gggccatggg tccggcgggc       540
     ggcaccttcc tgctgatcgt cagcgccatc ggcatcacct cgtggatgca gacggcgcgc       600
     atcctgcgcg gcgaggtgct gggcctcaag gagcgcgaat tcatcctggc cgcgcaatcc       660
     atcggcacgc cggcaccgcg catgatcctg cgccatgtcc tgcccaacgt gatctcgccc       720
     atcgtggtgg cggcgacgct gggcatcgcc acggcgatca tcaccgaaag cgcgctgtcc       780
     tttctggggc tgggctttcc gccggacttc ccgacctggg gacggctgct ctatgacgcg       840
     gtggaccaga tgcagatgta tccctggcgg gtggtgttgc cggggctgct gatctcgctg       900
     acggtgctgt cggtgaacta tatcggcgac gggttgcgcg atgccatgga cccgcggatc       960
     cgggggcgct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page