(data stored in ACNUC7421 zone)

EMBL: CP000489.PE603

CP000489.PE603       Location/Qualifiers
FT   CDS_pept        complement(582803..584503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0608"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: sil:SPO2814 peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68720"
FT                   /db_xref="GOA:A1AZM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM6"
FT                   /protein_id="ABL68720.1"
FT                   /translation="MKLKTLMLGAAATAAMAPAAFAERGSDGQVNVIMWQAPSTMNPYL
FT                   SAGTKDIIAGSVVLEPLASFTPEGEVVPRLAAEIPSVENGGISEDLKTVTWKLQPDIKW
FT                   SDGTPFTAEDVAFTAEYCMSPNGGCAQLAKFEGVEKVEAVDELTVRVTFVSPRPDPFSA
FT                   FVGAQSPILQKAQFQNCLGEAAPTCTQQNFNPVGTGAFVVKEFRTNDVISFAANPEYRD
FT                   PAKPAFATLLMKGGGDSAAAARAVLETGEFDYAWNTQLAPDVIAGMEAAGKGKNVAAFG
FT                   SLVERIHVNLTDPSPGLPEGERSTVKHPHPILTDPAVRKALSMAIDRELLTEIGYGPAG
FT                   QPTCNLVPAPAAWASENTECFTQDIEGAKALLDEAGWTVGAGGVREKDGKRLTLLFQTS
FT                   VNAVRQDFQALIKQWWSEIGVETELKVVDPSVFFGGDAGSPDTFQKLYADVEMYANNFE
FT                   GSNPEPYLARQTCDKAPGPENQWQGENTSRYCDPEYDRLIAEMTQIVDPAERGAMGRRL
FT                   NEMLTKDSNAIIPLVYRGTTSAHANSLGGVALNAWDSELWNVADWHRVK"
     atgaaactga aaaccctgat gctgggcgcg gcggccaccg ccgccatggc cccggccgca        60
     ttcgccgagc ggggcagcga cgggcaggtc aatgtcatca tgtggcaggc gccctcgacg       120
     atgaacccgt atctgtcggc cggcaccaag gacatcatcg ccggcagcgt agtgctggag       180
     ccgctggcca gcttcacccc cgagggcgag gtggtgccgc gcctggcggc cgagatcccg       240
     tcagtcgaaa acggcggcat ttccgaggat ctgaagacgg tcacctggaa attgcagccg       300
     gacataaaat ggtcggacgg cacgcccttc accgccgagg acgtggcctt taccgcggaa       360
     tattgcatga gcccgaacgg cggctgcgcc cagcttgcca agttcgaggg cgtcgaaaag       420
     gtcgaggcgg tcgatgagct gaccgtgcgc gtgaccttcg tctcgccccg gcccgatccc       480
     ttttcggcct tcgtgggggc gcaatcgccg atcctgcaaa aggcgcagtt ccagaattgc       540
     ctgggcgagg cggcgccgac ctgcacccag cagaacttca accccgtcgg caccggcgcc       600
     ttcgtggtca aggaattccg caccaacgac gtgatctcgt ttgccgccaa tcccgaatat       660
     cgcgacccgg caaagcccgc cttcgccacg ctgctgatga agggcggcgg cgattcggcg       720
     gcggcggcgc gcgccgtgtt ggaaacgggc gagttcgact atgcctggaa cacccagctt       780
     gccccggacg tgatcgccgg catggaggcg gccggcaagg gcaagaacgt cgccgccttc       840
     ggcagcctgg tcgagcgcat ccatgtcaac ctgaccgatc cttcgcccgg gctgcccgag       900
     ggcgagcgct cgacggtcaa gcatccgcat ccgatcctga ccgacccggc ggtgcgcaag       960
     gcgctgtcca tggccatcga ccgggaattg ctgaccgaga tcggctatgg cccggccggg      1020
     cagccgacct gcaacctggt gccggcgccc gccgcctggg catccgagaa taccgaatgc      1080
     ttcacccagg acatcgaggg ggcaaaggcg ttgctggacg aggcgggctg gaccgtcggc      1140
     gcgggcggcg tgcgcgaaaa ggacggcaag cggcttacgc tgctgttcca gacctcggtc      1200
     aacgcggtgc gccaggactt ccaggcgctg atcaagcaat ggtggtccga gatcggcgtc      1260
     gagaccgagc tgaaggtggt ggacccctcg gtcttcttcg gcggcgatgc cggctcgccc      1320
     gacacgttcc aaaagctcta tgccgatgtc gagatgtatg ccaacaactt cgagggctcg      1380
     aaccccgagc cctatctggc gcggcagacc tgcgacaagg cgccggggcc ggaaaaccag      1440
     tggcagggcg agaataccag ccgctattgc gacccggaat acgaccggct gatcgccgag      1500
     atgacgcaga tcgtcgatcc ggccgagcgc ggcgccatgg gccggcgcct gaacgagatg      1560
     ctgaccaagg acagcaacgc catcatcccg ctggtctatc gcggcacgac ctcggcccat      1620
     gccaacagtc tgggcggggt ggcgctgaac gcctgggaca gcgagttgtg gaacgtcgcc      1680
     gactggcatc gcgtgaagtg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page