(data stored in ACNUC7421 zone)

EMBL: CP000489.PE604

CP000489.PE604       Location/Qualifiers
FT   CDS_pept        584724..586553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0609"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: sil:SPO2813
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68721"
FT                   /db_xref="GOA:A1AZM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM7"
FT                   /protein_id="ABL68721.1"
FT                   /translation="MLDTKPLVRIEGLRVEFQTHDGPVTGVEDLSFDIRPGECLCVVGE
FT                   SGSGKSVSSLSLMRLVEFGGGEIANGRLLFQRERDEIDLAKAPPAAMRDIRGNEIAMIF
FT                   QEPMTALNPVFTVGEQLAEGLIVHRGLTRAQARARAPELLHEVRIPEPERRLRQYPHEL
FT                   SGGMRQRVVIAMAMACRPRLLICDEPTTALDVTIQAEILTLIDRLKRETGMAVLFITHD
FT                   MAVVAQMADRVVVMFRGNKVEEGPVGQIFEAPREPYTQALLAAVPRLGEMTGRDAPEPM
FT                   RLMREGQVARPEPVIPPAPAPLLVVRNLCTRFAVKGGILRRTVAQVHAVEDVSFTVNAG
FT                   ETLSLVGESGCGKSTTGRSILRLVEPSSGQVSLGGRDILALGASDLRKARRDMQMIFQD
FT                   PFASLDPQMRLLDQIEEPMLNYGIGNRVERRDRIARLFDRVELPRGFMKRYPHELSGGQ
FT                   RQRIAIARALALNPKLIIADEAVSALDVSVQAQVLNLLMELQRDLGISMLFISHDMAVV
FT                   ERVSHHVGVMYLGRIVEIGTRRQVFENPQHGYTRQLMAAVPVADPRRRKIGEDLRFRPI
FT                   PSPIHPVGHVPAPSVYREVAPGHLVLAEPATHG"
     atgctggaca cgaagccgct ggtcaggatc gaggggttgc gggtcgagtt ccagacccat        60
     gacggcccgg tcacgggcgt cgaggatctg tccttcgaca tccggcccgg cgaatgcctt       120
     tgcgtggtgg gcgaatccgg ctcgggcaaa tcggtcagtt cgctgtcgct gatgcggctg       180
     gtggaattcg gcggcggcga gatcgccaat ggccggctgc tgttccagcg cgagcgggac       240
     gagatcgacc tcgccaaggc cccgcccgcc gcgatgcgcg acattcgcgg caacgagatc       300
     gcgatgatct tccaggagcc gatgacggcg ctgaacccgg tctttaccgt gggcgagcag       360
     ctggccgagg ggctgatcgt gcatcgcggc ctgacgcgcg cccaggcccg cgcccgcgcg       420
     ccggagctgt tgcacgaggt gcgcatcccc gaacccgagc ggcggttgcg gcagtatccg       480
     cacgagcttt cgggcgggat gcgccagcgc gtcgtcatcg ccatggcgat ggcttgccgc       540
     ccgcgcctgc tgatctgcga cgagccgacc acggcgctgg acgtgaccat ccaggccgag       600
     atcctgaccc tgatcgaccg cctgaagcgc gagaccggca tggcggtgct gttcatcacc       660
     catgacatgg cggtggtggc gcagatggcc gaccgcgtcg tggtcatgtt ccgcggcaac       720
     aaggtcgagg aaggcccggt cggccagatc ttcgaagccc cgcgcgagcc ttatacccag       780
     gcgctgcttg ccgccgtgcc gcggctgggc gagatgaccg ggcgcgatgc gcccgagccg       840
     atgcggctga tgcgcgaggg gcaggtggcg cggcccgagc ccgtgatccc gcctgcgccc       900
     gcgccgctgc tggtggtcag gaacctttgc acccgctttg cggtcaaggg cggcatcctg       960
     cgccgcaccg tggcgcaggt ccatgcggtc gaggacgtct cctttaccgt caatgccggc      1020
     gagaccctgt cgctggtggg cgaatcgggc tgcggcaagt ccaccaccgg acgctcgatc      1080
     ctgcggctgg tcgagccgag ttcgggccag gtcagccttg gcgggcgcga catcctggcc      1140
     ctgggtgcat ctgatctgcg caaggcgcgg cgcgacatgc agatgatctt ccaggacccg      1200
     ttcgccagcc tcgacccgca gatgcgcctg ctcgaccaga tcgaggagcc gatgctgaac      1260
     tacggcatcg gcaaccgcgt cgagcgccga gaccgcatcg cccggctttt cgaccgggtg      1320
     gaactgccgc gcggcttcat gaagcgttac ccgcacgagc tgtcgggcgg ccagcgccag      1380
     cgcatcgcca tcgcccgcgc cctggcgctg aacccgaagc tcatcatcgc cgacgaggcg      1440
     gtctcggcgc tggacgtttc ggtgcaggcg caggtgctga acctgctgat ggaattgcag      1500
     cgcgaccttg gcatctcgat gctgttcatc agccatgaca tggcggtggt cgagcgcgtc      1560
     agccatcatg tcggcgtcat gtatctgggc cgcatcgtcg agatcggcac ccgcaggcag      1620
     gtcttcgaga acccgcagca cggctatacc cgccagttga tggccgccgt gccggtcgcc      1680
     gatccgcgcc gccgcaagat cggcgaggac ctgcgctttc gtcccatccc ctcgccgatc      1740
     catcccgtcg gccatgtgcc cgcgccctcg gtctatcgcg aggtggcgcc cggccatctg      1800
     gtgctggccg agccggcgac gcatggataa                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page