(data stored in ACNUC7421 zone)

EMBL: CP000489.PE605

CP000489.PE605       Location/Qualifiers
FT   CDS_pept        586652..587821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0610"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sit:TM1040_0719 peptidase M20D,
FT                   amidohydrolase; TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68722"
FT                   /db_xref="GOA:A1AZM8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM8"
FT                   /protein_id="ABL68722.1"
FT                   /translation="MPVKNRFAELLPEITAWRRDFHENPELDYQVHRTAGRVAELLRGF
FT                   GVDEVNEGVGRTGVVGVIRGRSNSSGRVIGLRADMDALPINEQTGAEYASKNPGVMHAC
FT                   GHDGHTAMLLGAAKYLAETRNFDGTAVVIFQPAEEGGAGGLAMVQDGLVDRWGIQEFYG
FT                   MHNMPGYPTGSFAIREGAMMAAADQFDIVVTGKGGHAAKPHEAIDTTLVAAQIIVALQS
FT                   IVARNVDPLKSGVISVCVVQTDSTAHNVIPQVVKLKGTARSLAPEVRDQLEEGIKRVAT
FT                   HTAAAFGAAAEVTYDRGYPVTMNHPEATGFAAEVARQVAGEVNMEMEPLMAGEDFSYML
FT                   NERPGAYIFVGNGDTAMVHHPAYDFDDNAIPAGSSWYAGMVEARMPILA"
     atgcccgtca agaaccgctt tgccgaattg ctgcccgaga tcaccgcctg gcgccgcgac        60
     ttccacgaga atcccgagct cgactatcag gtccaccgca ccgccggccg cgtggccgag       120
     ctgctgcgcg gcttcggcgt ggacgaggtg aacgagggcg tcggccgcac cggcgtggtg       180
     ggcgtcatca ggggccgcag caacagcagc ggccgggtga tcgggctgcg tgccgacatg       240
     gatgcgctgc cgatcaacga gcagaccggg gcggaatatg cctcgaaaaa tccgggggtc       300
     atgcatgcct gcggccatga cggccatacc gccatgctgc tgggcgcggc gaaatacctg       360
     gccgagacgc gcaatttcga cggcaccgcc gtggtgatct tccagcccgc cgaagagggc       420
     ggggcaggcg gcctggccat ggtgcaggac ggtttggtgg atcgctgggg catccaggaa       480
     ttctatggca tgcacaatat gcccggctat ccgaccggca gttttgccat ccgcgagggt       540
     gccatgatgg ccgccgccga ccagttcgac atcgtggtca ccggcaaggg cgggcacgcc       600
     gccaagccgc atgaggcgat cgacaccacc ttggtcgcgg cgcagatcat cgtggcgctg       660
     caatccatcg tggcgcgcaa tgttgatccg ctgaaaagcg gcgtgatctc ggtctgcgtg       720
     gtgcagaccg attccaccgc gcataacgtc atccctcagg tggtgaagct gaagggcacc       780
     gcccgcagcc ttgcccccga ggtgcgcgac cagctggaag agggcatcaa gcgcgtcgcc       840
     acccataccg ccgcggcctt cggcgccgcg gccgaggtga catacgaccg cggctatccg       900
     gtgacgatga accaccccga agcaaccggg ttcgcggccg aggtggcgcg ccaggtggcg       960
     ggcgaggtga acatggagat ggagccgctg atggcgggcg aggatttcag ctatatgctg      1020
     aacgaacgtc ccggcgccta tatcttcgtc ggcaatggcg acaccgccat ggtgcatcac      1080
     cccgcctatg atttcgacga caatgcgatt ccggccgggt cgagctggta tgccggcatg      1140
     gtcgaggcgc ggatgccgat cctggcgtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page