(data stored in ACNUC7421 zone)

EMBL: CP000489.PE606

CP000489.PE606       Location/Qualifiers
FT   CDS_pept        complement(587908..589299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0611"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD dependent oxidoreductase; KEGG: rsp:RSP_2968
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68723"
FT                   /db_xref="GOA:A1AZM9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM9"
FT                   /protein_id="ABL68723.1"
FT                   /translation="MAQSFDMVVIGSGPGGYVCAIRGAQLGLKVACIEREHLGGICLNW
FT                   GCIPTKALLRSAEVFHLMHRAKEFGLSADKIGYDLGAVVQRSRGVAKQLAGGVGHLLKK
FT                   NKVTVIMGEASLTAPGKISVKTDKGTEEVTGKAIVLATGARARELPGLEPDGDLVWNYK
FT                   HALQPPRMPKKLLVIGSGAIGIEFASFFNTLGADTTVVEVMDRVLPVEDAEISALAKKQ
FT                   FVKQGMKILEKAAVKKLDRAKGKVTAHIETGGKTETHEFDTVISAVGIVGNVENLGLEK
FT                   LGAKIDRTHVVTDEYCRTGVEGLYAIGDVAGAPWLAHKASHEGVMVAELIAGGHPHPIK
FT                   PNSIPGCTYCNPQVASVGLTEEKAKAAGYEVKVGRFPFIGNGKAIALGEPEGLIKTVFD
FT                   AKTGELLGAHMVGAEVTELIQGYVVGRTLETTEAELMETVFPHPTLSEMLHEATLSAYG
FT                   RAIHF"
     atggcgcaga gctttgacat ggtggtgatc ggttccggcc ctggcggcta tgtctgcgcc        60
     atccgcggcg cgcagttggg gctgaaggtg gcctgtatcg agcgcgagca tctgggcggc       120
     atctgcctga actggggctg catcccgacc aaggcgctgc tgcgttcggc cgaggtcttt       180
     cacctcatgc accgcgccaa ggagttcggg ctgtccgccg acaagatcgg ctacgatctc       240
     ggcgccgtgg tgcaacgctc gcgcggcgtg gccaaacaac tcgccggcgg cgtcggccac       300
     ctgctgaaaa agaacaaggt caccgtcatc atgggcgagg ccagcctgac cgcccccggc       360
     aagatcagcg tcaagaccga caagggcacc gaggaagtca cgggcaaggc catcgtgctc       420
     gccaccggcg cccgcgcccg cgaattgccg ggactggagc cggacggcga cctggtctgg       480
     aactacaagc acgccctgca gccgccgcgc atgccgaaaa agctgctggt catcggctcg       540
     ggcgccatcg gcatcgaatt cgccagcttc ttcaacacgc tgggcgccga caccaccgtg       600
     gtcgaggtca tggaccgcgt gttgccggtc gaggatgccg agatctcggc gctggccaag       660
     aaacagttcg tcaagcaagg catgaagatc ctggaaaagg cggcggtcaa gaaactcgac       720
     cgcgccaaag gcaaggtcac cgcccatatc gagaccggcg gcaagaccga aacgcatgag       780
     ttcgacacgg tgatctcggc cgtcggcatc gtcggcaacg tcgaaaacct cgggctggaa       840
     aaactgggcg ccaagatcga ccgcacccat gtcgtcaccg acgaatattg ccgcaccggc       900
     gtcgaggggc tctatgccat cggcgacgtg gccggcgcgc cctggctcgc gcacaaggcc       960
     agccatgaag gcgtcatggt ggccgaactg atcgccggcg ggcacccgca tccgatcaag      1020
     ccgaattcga tccccggctg cacctattgc aacccgcagg tcgcctccgt cggcctgacc      1080
     gaggaaaagg ccaaggccgc cggctacgag gtcaaggtcg gccgcttccc cttcatcggc      1140
     aacggcaagg ccatcgcgct cggcgaaccc gaggggctga tcaagaccgt cttcgacgcc      1200
     aagaccggcg agcttctggg cgcccacatg gtcggggccg aggtgaccga gctgatccag      1260
     ggctatgtcg tcggccgcac gctggagacc accgaggccg aactgatgga gacggtcttc      1320
     ccgcacccga cgctgtcgga aatgctgcat gaggccacgc tctcggccta tggccgcgcc      1380
     atccatttct ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page