(data stored in ACNUC7421 zone)

EMBL: CP000489.PE609

CP000489.PE609       Location/Qualifiers
FT   CDS_pept        complement(591234..592313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0614"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   rsp:RSP_2971 S-adenosylmethionine tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68726"
FT                   /db_xref="GOA:A1AZN2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN2"
FT                   /protein_id="ABL68726.1"
FT                   /translation="MARTEPKPMKLDDFDFHLPETLIATRPARPRSSARLLLAQGDSIR
FT                   DLHVRDLADLLGSGDLLVLNDTKVIPARLNGTRARQTPQGEAVAKVEVTLLEPVAHGWK
FT                   ALAKPLRKLKPGEVIRFGSALSAEVAEIAGGELTLRFDATGEAFDAALAQVGAMPLPPY
FT                   IAALRAPDEADRQDYQTVWARNSGAVAAPTASLHFDGELLDGLAARGVRFTHVTLHVGA
FT                   GTFLPVKVEDVTTHKMHGEWGEVTPEAAAAINATRAAGGRVIPVGTTALRLIESAAAED
FT                   GTVHPFQGVTEIFIYPGYRFRVTDALMTNFHLPKSTLLMLVSALMGQDRIRGIYRHAVE
FT                   SGYRFFSYGDASLLIPKDP"
     atggcccgga cagaacctaa gcccatgaag ctggacgatt tcgactttca cctgcccgag        60
     acattgatcg cgacgcgccc ggcgcggccg cgttcctcgg cgcggctgct gctggcgcag       120
     ggcgattcga ttcgcgacct gcatgtgcgc gacctggcgg atctgctggg ttcgggcgac       180
     ctgctggtgc tgaacgacac caaggtcatc ccggcgcggc tgaacggcac ccgcgcccgc       240
     cagaccccgc agggcgaggc ggtggcaaag gtcgaggtca cgctgctgga gcccgtcgcc       300
     catggctgga aggcgctggc gaagccgctg cgcaagctga agccgggcga ggtgatccgc       360
     ttcggcagcg cgctgtccgc cgaggtggcc gagatcgccg ggggcgagct gaccctgcgc       420
     ttcgacgcca cgggcgaggc gttcgacgcc gcgctggcgc aggtcggcgc catgccgctg       480
     ccgccctata tcgccgcgct gcgcgccccg gacgaggccg accgccagga ctaccagacc       540
     gtctgggcac gcaattccgg cgccgtcgcc gcccccaccg ccagcctgca tttcgacggc       600
     gagttgctgg acgggctggc ggccaggggc gtgcgcttca cccatgtcac cctgcatgtc       660
     ggcgccggca ccttcctgcc ggtcaaggtc gaggacgtga ccacccacaa gatgcacggc       720
     gaatggggcg aggtcacgcc cgaggcggcg gcggcgatca acgccacccg cgccgcgggc       780
     gggcgggtga tccccgtcgg caccacggcg ctgcggctga tcgaatcggc ggctgccgag       840
     gacggcaccg tccatccctt ccagggcgtt accgaaatct tcatctatcc cggctatcgc       900
     tttcgcgtga cggatgcgct gatgaccaat ttccacctgc cgaaatcgac cctgctgatg       960
     ctggtcagcg ccctgatggg ccaggaccgg atccgcggga tctatcgcca tgcggtggaa      1020
     tcgggctatc gcttcttcag ctatggcgac gcctccctgc tgattccgaa ggacccgtga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page