(data stored in ACNUC7421 zone)

EMBL: CP000489.PE612

CP000489.PE612       Location/Qualifiers
FT   CDS_pept        complement(593194..593868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0617"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: rsp:RSP_2504 phosphoglycolate phosphatase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68729"
FT                   /db_xref="GOA:A1AZN5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN5"
FT                   /protein_id="ABL68729.1"
FT                   /translation="MAGTVVFDLDGTLADTSGDLIAAANACFQARGLGPLLDPVEDALI
FT                   AFHGGRAMLRAGYGRLPADRLLPPGAEDEDYPRLLVHYGKAIAVHTRLYPGTEAALEQL
FT                   AAAGHRLAVCTNKPAALAETLLRQLGIRDRFAAMIGADTLPVRKPDPRPYAAAVEAAGG
FT                   TVARSFLVGDTETDRKTAAAAGVRVALVAFGPEGEALRRLAPEAMLAHFDDLPGLAADW
FT                   LA"
     atggcaggaa cggtggtctt cgatctggac ggcacgctgg ccgacacctc gggcgacctg        60
     atcgcggcgg cgaatgcctg ctttcaggcg cgcggcctgg gcccgctgct ggacccggtc       120
     gaggatgcgc tgatcgcctt tcacggcggg cgggccatgc tgcgggcggg ctatggccgc       180
     ctgcccgccg accggctgct gccgcccggc gccgaggacg aggactatcc ccgcctgctg       240
     gtgcattacg gcaaggccat agccgtgcat acgcggcttt atcccggcac cgaggccgcg       300
     ctggagcaac tggcggcagc cggtcaccgg cttgcggtct gcaccaacaa gcccgccgcc       360
     ctggccgaga cattgctgcg ccaactgggc atccgcgacc gcttcgccgc gatgatcggc       420
     gccgacacgc tgccggtgcg caagcccgat ccccgcccct atgccgccgc ggtcgaggca       480
     gcgggcggga cggtggcgcg atccttcctg gtcggcgata ccgaaaccga ccgcaagacc       540
     gcagccgccg ccggtgtgcg ggtggcgctg gtcgccttcg gccccgaggg agaggcgctg       600
     cgccgcctgg cgcccgaggc gatgctggcg catttcgacg acttgccggg cctggccgcc       660
     gactggctgg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page