(data stored in ACNUC7421 zone)

EMBL: CP000489.PE617

CP000489.PE617       Location/Qualifiers
FT   CDS_pept        598844..599713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0622"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   sit:TM1040_2376 ribosomal L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68734"
FT                   /db_xref="GOA:A1AZP0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP0"
FT                   /protein_id="ABL68734.1"
FT                   /translation="MATWTALTHTIGREAAEALAEAGEDLTPEPVGSGVFEIEDGSNRW
FT                   EVGLYFTEAPDDVALALLAAAWNAEPFVVSELPEVDWVAHVRRELSPVEAGRFFVHGGH
FT                   DVDKVPAGAEALLIEAAMAFGTGHHATTKGCLLALDRLIAEGVEPRRIVDIGCGTAVLA
FT                   MAAARSFPVIVLAGDIDPQAVDVARANVIANGLDGRVECVEAVGFDHPLIENAAPFDLV
FT                   FANILKQPLIDLVPDMARHLASGGRAILSGILATQAEEVIAAYAAGGLTLERRDDMGEW
FT                   STLVVRRG"
     atggcgacct ggaccgcgct gacccacacc atcggacgcg aggcggccga ggcgcttgcc        60
     gaggcgggcg aggatctgac ccccgagccc gtcggcagcg gcgtcttcga gatcgaggat       120
     ggctcgaacc gctgggaggt agggctttac ttcaccgagg cccccgacga cgtggccctg       180
     gcgcttctgg ctgcggcctg gaacgccgag cccttcgtgg tctcggaact gccggaggtg       240
     gattgggtgg cccatgtccg gcgcgagctt tcgccggtcg aggccggacg cttcttcgtc       300
     catggcggcc atgatgtcga caaggtgccc gcgggcgccg aggcgctgct gatcgaggcg       360
     gcgatggcct tcggcaccgg ccatcacgcc acgaccaagg gttgcctgct ggcgctggac       420
     cggctgatcg ccgagggcgt cgagccacgg cgcatcgtcg acatcggctg cggcacggcg       480
     gttctggcca tggcggcggc gcggtcgttc ccggtgatcg tgctggcggg tgacatcgac       540
     ccgcaggcgg tggacgtggc ccgcgccaat gtcatcgcca acgggctgga cgggcgcgtc       600
     gaatgtgtcg aggcggtcgg cttcgaccat ccgctgatcg agaacgcggc gcctttcgac       660
     ctggttttcg ccaatatcct gaagcagccg ctgatcgacc tggtgccgga tatggcacgt       720
     catcttgcgt cgggcggcag ggcgatcctg tcgggcatcc tggccaccca ggccgaggaa       780
     gtaatcgcgg cctatgcggc aggcgggctg acgctggagc ggcgcgacga tatgggcgaa       840
     tggtccaccc tggtcgtcag gcgcggctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page