(data stored in ACNUC7421 zone)

EMBL: CP000489.PE625

CP000489.PE625       Location/Qualifiers
FT   CDS_pept        complement(606107..607291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0630"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rde:RD1_0935 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68742"
FT                   /db_xref="GOA:A1AZP8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP8"
FT                   /protein_id="ABL68742.1"
FT                   /translation="MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPI
FT                   MRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGAL
FT                   RQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADL
FT                   AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDA
FT                   AGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYS
FT                   FPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAE
FT                   HRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV"
     atgctgggca atctgaaacc gcaggccccc gacaagatcc tggccctgat gggcgaattc        60
     agggccgatc cccgccaggg caagatcgac ctgggcgtgg gggtctacaa ggatgccacc       120
     ggccacaccc cgatcatgcg ggccgtccac gccgccgagc agcgcatgct ggaaaccgag       180
     accaccaaga cctatgccgg cctctcgggc gagcccgagt tccaaaaggc catgggcgag       240
     ctgatcctgg gcgacggact gaaatccgag accaccgcga cgctggcgac ggtcggcggc       300
     accggcgccc tccggcaggc gctggaactg gcgcgcatgg cgaacccgga cctgcgggtc       360
     ttcgtcagcg atccgacctg gccgaaccat gtctcgatca tgaatttcat gggcctgccg       420
     gtgcagacct atcgctattt cgatgccgag acccgcggcg tcgatttcga gggcatgaag       480
     gccgacctcg ccgccgcgaa aaagggcgac atggtgctgc tgcacggctg ctgccacaac       540
     ccgaccggcg ccaacctgac gctggatcaa tgggccgaga tcgcctcgat cctggaaaag       600
     accggcgcgc tgccgctgat cgacctggcc tatcagggct tcggcgacgg gctggaagag       660
     gacgcggccg gcacccggct gatcgcctcg cgcatccccg aggtgctgat cgcggcctcg       720
     tgcagcaaga acttcggcat ctaccgcgaa cgcaccggct gcctgctggc gctttgcgcc       780
     gatgcggcga ccagggagct ggcgcagggc gccatggcct tcctgaaccg ccagacctat       840
     tccttcccgc ccttccacgg cgccaagatc gtctcgaccg tgctgaccac gcccgaactg       900
     cgcgccgact ggatggccga gctggaagcg gtgcgcagcg gcatgctgcg cctgcgcgag       960
     caattggcgg gcgagttgcg cgatctcagc ggttcggacc gtttcggctt cgtggccgag      1020
     catcgcggca tgttctcgcg cctgggcgcc acgcccgaac aggtcaagcg catcaaggaa      1080
     gagttcggca tctacatggt gggcgattcg cgcatcaaca tcgccgggct gaacgacaac      1140
     accatcccga tcctggcccg cgctatcatc gaggtggggg tctaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page